prot_M-pyrifera_M_contig104329.920.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104329.920.1 vs. uniprot
Match: A0A7S4HYS1_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4HYS1_9EUKA) HSP 1 Score: 102 bits (253), Expect = 3.870e-24 Identity = 43/89 (48.31%), Postives = 65/89 (73.03%), Query Frame = 0 Query: 19 TAEPCTFTEGGFYSYDDVAQCFYSIRLDETFKLQTLDTMRKALELYTFFDIANHSPDPHLPVEIDMVAGLQQIEDRPYVYDMDFHSDMR 107 ++ PC F EG +Y Y++ +CF SI L + K TL T+ ++LELYTF+DIA++SPDP+LP++++M GLQ+I R Y+ D DF +D+R Sbjct: 21 SSSPCVFDEGEYYDYEETLECFMSIPLTDDIKFTTLATLNRSLELYTFYDIAHNSPDPNLPMQVNMQQGLQEIASRDYLTDFDFQNDLR 109 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104329.920.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104329.920.1 ID=prot_M-pyrifera_M_contig104329.920.1|Name=mRNA_M-pyrifera_M_contig104329.920.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=107bpback to top |