mRNA_L-elsbetiae_contig7305.16177.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Match: D7FMF6_ECTSI (SHR-BD domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMF6_ECTSI) HSP 1 Score: 92.0 bits (227), Expect = 1.680e-20 Identity = 42/46 (91.30%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 13 RYTVMNRCSCVLVVRQYGSDVTMELDPGESRPLHWADGSLEATLSV 150 RYTVMN+C CVLVVRQYGS+VTMEL PGESRPLHWADGSLEATLSV Sbjct: 910 RYTVMNKCDCVLVVRQYGSNVTMELGPGESRPLHWADGSLEATLSV 955
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Match: A0A6H5KXT8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXT8_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 2.930e-6 Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 1 Query: 79 MELDPGESRPLHWADGSLEATLSV 150 MEL PGESRPLHWADGSLEATLSV Sbjct: 1 MELGPGESRPLHWADGSLEATLSV 24 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7305.16177.1 >prot_L-elsbetiae_contig7305.16177.1 ID=prot_L-elsbetiae_contig7305.16177.1|Name=mRNA_L-elsbetiae_contig7305.16177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bp MNRCSCVLVVRQYGSDVTMELDPGESRPLHWADGSLEATLSVback to top mRNA from alignment at L-elsbetiae_contig7305:2000..2149+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7305.16177.1 ID=mRNA_L-elsbetiae_contig7305.16177.1|Name=mRNA_L-elsbetiae_contig7305.16177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=150bp|location=Sequence derived from alignment at L-elsbetiae_contig7305:2000..2149+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7305:2000..2149+ >mRNA_L-elsbetiae_contig7305.16177.1 ID=mRNA_L-elsbetiae_contig7305.16177.1|Name=mRNA_L-elsbetiae_contig7305.16177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=252bp|location=Sequence derived from alignment at L-elsbetiae_contig7305:2000..2149+ (Laminarionema elsbetiae ELsaHSoW15)back to top |