prot_L-elsbetiae_contig7305.16177.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Match: D7FMF6_ECTSI (SHR-BD domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMF6_ECTSI) HSP 1 Score: 84.0 bits (206), Expect = 8.160e-18 Identity = 38/42 (90.48%), Postives = 40/42 (95.24%), Query Frame = 0 Query: 1 MNRCSCVLVVRQYGSDVTMELDPGESRPLHWADGSLEATLSV 42 MN+C CVLVVRQYGS+VTMEL PGESRPLHWADGSLEATLSV Sbjct: 914 MNKCDCVLVVRQYGSNVTMELGPGESRPLHWADGSLEATLSV 955
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Match: A0A6H5KXT8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXT8_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 2.030e-6 Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 0 Query: 19 MELDPGESRPLHWADGSLEATLSV 42 MEL PGESRPLHWADGSLEATLSV Sbjct: 1 MELGPGESRPLHWADGSLEATLSV 24 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7305.16177.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7305.16177.1 ID=prot_L-elsbetiae_contig7305.16177.1|Name=mRNA_L-elsbetiae_contig7305.16177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bpback to top |