prot_L-elsbetiae_contig20290.6100.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Match: A0A6H5L4I1_9PHAE (CPO-like protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L4I1_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 9.660e-6 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MPTSVAASLDALTAGDASAAVLKRDLGELMLRPL 34 M S+AAS+D LTAGD S AV KRD+GELMLRPL Sbjct: 501 MAISIAASIDGLTAGDESVAVFKRDIGELMLRPL 534
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Match: A0A6H5JTZ2_9PHAE (CPO-like protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JTZ2_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 9.670e-6 Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 0 Query: 4 SVAASLDALTAGDASAAVLKRDLGELMLRPL 34 S+AAS+DALTAGD SAAV KRD+GEL+LRPL Sbjct: 454 SIAASIDALTAGDESAAVFKRDVGELVLRPL 484 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig20290.6100.1 ID=prot_L-elsbetiae_contig20290.6100.1|Name=mRNA_L-elsbetiae_contig20290.6100.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=35bpback to top |