mRNA_L-elsbetiae_contig20290.6100.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Match: A0A6H5L4I1_9PHAE (CPO-like protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L4I1_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 2.560e-8 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 1 VELCGGNQMPTSVAASLDALTAGDASAAVLKRDLGELMLRPL 126 VELCGG++M S+AAS+D LTAGD S AV KRD+GELMLRPL Sbjct: 493 VELCGGDEMAISIAASIDGLTAGDESVAVFKRDIGELMLRPL 534
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Match: A0A6H5JTZ2_9PHAE (CPO-like protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JTZ2_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 8.050e-8 Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 1 Query: 4 ELCGGNQMPTSVAASLDALTAGDASAAVLKRDLGELMLRPL 126 ELCGG+++ S+AAS+DALTAGD SAAV KRD+GEL+LRPL Sbjct: 444 ELCGGDEIAVSIAASIDALTAGDESAAVFKRDVGELVLRPL 484 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20290.6100.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig20290.6100.1 >prot_L-elsbetiae_contig20290.6100.1 ID=prot_L-elsbetiae_contig20290.6100.1|Name=mRNA_L-elsbetiae_contig20290.6100.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=35bp MPTSVAASLDALTAGDASAAVLKRDLGELMLRPL*back to top mRNA from alignment at L-elsbetiae_contig20290:547..1296+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig20290.6100.1 ID=mRNA_L-elsbetiae_contig20290.6100.1|Name=mRNA_L-elsbetiae_contig20290.6100.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=750bp|location=Sequence derived from alignment at L-elsbetiae_contig20290:547..1296+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig20290:547..1296+ >mRNA_L-elsbetiae_contig20290.6100.1 ID=mRNA_L-elsbetiae_contig20290.6100.1|Name=mRNA_L-elsbetiae_contig20290.6100.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=210bp|location=Sequence derived from alignment at L-elsbetiae_contig20290:547..1296+ (Laminarionema elsbetiae ELsaHSoW15)back to top |