prot_L-elsbetiae_contig12823.2271.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12823.2271.1 vs. uniprot
Match: A0A6H5KZR8_9PHAE (Ubiquitinyl hydrolase 1 n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KZR8_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 4.480e-15 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = 0 Query: 1 NFREEAGPCEYIVWYCRMLTSGFLKLNADRYL 32 NFREEAGPCEYIVWYCRMLTSGFLKLNADR+L Sbjct: 181 NFREEAGPCEYIVWYCRMLTSGFLKLNADRFL 212
BLAST of mRNA_L-elsbetiae_contig12823.2271.1 vs. uniprot
Match: A0A024G0R5_9STRA (OTU domain-containing protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024G0R5_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 1.110e-5 Identity = 18/31 (58.06%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 1 NFREEAGPCEYIVWYCRMLTSGFLKLNADRY 31 +F+ E G EY+VWY R+LT+G+LK NADR+ Sbjct: 192 DFQTEGGESEYLVWYARLLTAGYLKQNADRF 222
BLAST of mRNA_L-elsbetiae_contig12823.2271.1 vs. uniprot
Match: A0A7S1ADL7_NOCSC (Ubiquitinyl hydrolase 1 n=1 Tax=Noctiluca scintillans TaxID=2966 RepID=A0A7S1ADL7_NOCSC) HSP 1 Score: 47.4 bits (111), Expect = 5.170e-5 Identity = 17/32 (53.12%), Postives = 24/32 (75.00%), Query Frame = 0 Query: 1 NFREEAGPCEYIVWYCRMLTSGFLKLNADRYL 32 F EE G EY+VWYCR L++GFLK + +R++ Sbjct: 164 QFNEENGGAEYMVWYCRALSAGFLKADPERFM 195
BLAST of mRNA_L-elsbetiae_contig12823.2271.1 vs. uniprot
Match: M4C1S8_HYAAE (Ubiquitinyl hydrolase 1 n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4C1S8_HYAAE) HSP 1 Score: 47.0 bits (110), Expect = 7.030e-5 Identity = 16/31 (51.61%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 1 NFREEAGPCEYIVWYCRMLTSGFLKLNADRY 31 +F+ E G EY+VWY R+LT+G++K NA+R+ Sbjct: 138 DFQTEGGEAEYLVWYMRLLTAGYMKKNAERF 168 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12823.2271.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12823.2271.1 ID=prot_L-elsbetiae_contig12823.2271.1|Name=mRNA_L-elsbetiae_contig12823.2271.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|