prot_L-elsbetiae_contig12653.2143.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12653.2143.1 vs. uniprot
Match: A0A6H5L840_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L840_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 3.370e-9 Identity = 43/97 (44.33%), Postives = 51/97 (52.58%), Query Frame = 0 Query: 18 ASGSGEAVVADRMTCATAGRRCTVPGTRRGRVMATGAIVSSIAPRNDAPHVFRSTSPSEFGRVHGG--CWCVQCAPILALHWETVLVIDANGHAYEL 112 A G G A V +TCATAGR CTV GTR G V+ +G I + + R A VF SEFGR+ G CW VQC + V ID G YE+ Sbjct: 281 ARGGGVAAVEGHVTCATAGRSCTVLGTRHGAVLFSGFITTMTSNRFCA--VF-----SEFGRLGDGLRCWRVQCECLPVTDTTVVTAIDPAGQVYEV 370
BLAST of mRNA_L-elsbetiae_contig12653.2143.1 vs. uniprot
Match: D8LDL9_ECTSI (Hect E3 ubiquitin ligase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDL9_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 5.470e-8 Identity = 41/97 (42.27%), Postives = 50/97 (51.55%), Query Frame = 0 Query: 18 ASGSGEAVVADRMTCATAGRRCTVPGTRRGRVMATGAIVSSIAPRNDAPHVFRSTSPSEFGRVHGG--CWCVQCAPILALHWETVLVIDANGHAYEL 112 A G G V +TCATAGR CTV GTR G V+ +G + S N VF SEFGR+ G CW VQC + A V+ ID G Y++ Sbjct: 282 ARGGGVVAVEGHVTCATAGRSCTVLGTRHGVVLFSGLM--STMTSNHFCAVF-----SEFGRLGDGLRCWRVQCECLPATGTTLVMAIDPAGQVYDV 371 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12653.2143.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12653.2143.1 ID=prot_L-elsbetiae_contig12653.2143.1|Name=mRNA_L-elsbetiae_contig12653.2143.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=137bpback to top |