prot_L-elsbetiae_contig11613.1399.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11613.1399.1 vs. uniprot
Match: D7FXY7_ECTSI (EsV-1-199 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXY7_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 1.370e-9 Identity = 38/74 (51.35%), Postives = 50/74 (67.57%), Query Frame = 0 Query: 10 LLVKAGADL---WEEDLCYTGSTPLDLAAENGPSKMMRVLIEARASPNSRRLVGSTPLFRAALEKHVDAVKVLL 80 +LV+AGA L ++ LC TPL +AA NG + M L+EA A+ NSRR G+TPLF AA E +VDAV++LL Sbjct: 1 MLVEAGAPLEVATKQQLC----TPLQIAAVNGCAASMTTLLEAGANLNSRRFDGATPLFLAAWEGNVDAVRLLL 70
BLAST of mRNA_L-elsbetiae_contig11613.1399.1 vs. uniprot
Match: UPI001F5D8C51 (ankyrin repeat, PH and SEC7 domain containing protein secG-like n=1 Tax=Lolium rigidum TaxID=89674 RepID=UPI001F5D8C51) HSP 1 Score: 49.3 bits (116), Expect = 6.370e-5 Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 10 LLVKAGADLWEEDLCYTGSTPLDLAAENGPSKMMRVLIEARASPNSRRLVGSTPLFRAALEKHVDAVKVLL 80 L+ ++G D+ + TG+TP+ AA G ++MR L++ P GSTPL RAA+ H +AV++LL Sbjct: 57 LVEESGIDV--NSVSKTGATPMSYAAREGNVQVMRYLLDRGGDPAMPDERGSTPLHRAAVHGHCEAVRLLL 125 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11613.1399.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11613.1399.1 ID=prot_L-elsbetiae_contig11613.1399.1|Name=mRNA_L-elsbetiae_contig11613.1399.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=80bpback to top |