mRNA_L-elsbetiae_contig19275.5704.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 6.090e-18 Identity = 45/52 (86.54%), Postives = 46/52 (88.46%), Query Frame = 1 Query: 1 NRQIRKICKYLCLTVNRLARTRDGSFSLGKVRAGGVAGVEILKACPRRLEEG 156 NRQIRKICKYLCLTVNRLARTR G FSLGKVRAGGVA VEI KA RRLE+G Sbjct: 324 NRQIRKICKYLCLTVNRLARTRYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 375
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Match: A0A6H5J790_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J790_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 9.230e-15 Identity = 39/47 (82.98%), Postives = 40/47 (85.11%), Query Frame = 1 Query: 16 KICKYLCLTVNRLARTRDGSFSLGKVRAGGVAGVEILKACPRRLEEG 156 KICKYLCLTVNRLART G FSLGKVRAGGVA VEI KA RRLE+G Sbjct: 42 KICKYLCLTVNRLARTGYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 88 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19275.5704.1 >prot_L-elsbetiae_contig19275.5704.1 ID=prot_L-elsbetiae_contig19275.5704.1|Name=mRNA_L-elsbetiae_contig19275.5704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=97bp NRQIRKICKYLCLTVNRLARTRDGSFSLGKVRAGGVAGVEILKACPRRLEback to top mRNA from alignment at L-elsbetiae_contig19275:557..847+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19275.5704.1 ID=mRNA_L-elsbetiae_contig19275.5704.1|Name=mRNA_L-elsbetiae_contig19275.5704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=291bp|location=Sequence derived from alignment at L-elsbetiae_contig19275:557..847+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19275:557..847+ >mRNA_L-elsbetiae_contig19275.5704.1 ID=mRNA_L-elsbetiae_contig19275.5704.1|Name=mRNA_L-elsbetiae_contig19275.5704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=582bp|location=Sequence derived from alignment at L-elsbetiae_contig19275:557..847+ (Laminarionema elsbetiae ELsaHSoW15)back to top |