prot_L-elsbetiae_contig19275.5704.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 6.090e-18 Identity = 45/52 (86.54%), Postives = 46/52 (88.46%), Query Frame = 0 Query: 1 NRQIRKICKYLCLTVNRLARTRDGSFSLGKVRAGGVAGVEILKACPRRLEEG 52 NRQIRKICKYLCLTVNRLARTR G FSLGKVRAGGVA VEI KA RRLE+G Sbjct: 324 NRQIRKICKYLCLTVNRLARTRYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 375
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Match: A0A6H5J790_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J790_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 9.230e-15 Identity = 39/47 (82.98%), Postives = 40/47 (85.11%), Query Frame = 0 Query: 6 KICKYLCLTVNRLARTRDGSFSLGKVRAGGVAGVEILKACPRRLEEG 52 KICKYLCLTVNRLART G FSLGKVRAGGVA VEI KA RRLE+G Sbjct: 42 KICKYLCLTVNRLARTGYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 88 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19275.5704.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19275.5704.1 ID=prot_L-elsbetiae_contig19275.5704.1|Name=mRNA_L-elsbetiae_contig19275.5704.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=97bpback to top |