mRNA_L-elsbetiae_contig1144.1259.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Match: A0A6H5JCV6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCV6_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 5.330e-14 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 1 Query: 178 PSAFSPTAANPLHAHLDVLAVAAPRLLGEAPPDFRLSAVSYRIAALERQLQQQ 336 PS + PT+ NPLHAHL+ LA AAP LL EAPPDFRLSA S+RIAALE QL+QQ Sbjct: 314 PSLYVPTSPNPLHAHLEALAAAAPHLLAEAPPDFRLSATSHRIAALEEQLRQQ 366
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Match: D7FKD5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKD5_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 1.000e-13 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 181 SAFSPTAANPLHAHLDVLAVAAPRLLGEAPPDFRLSAVSYRIAALERQLQQQ 336 S + PT+ NPLHAHL+ LA AAPRLL EAPPDFRLSA+S+RIA LE QL+QQ Sbjct: 262 SLYVPTSPNPLHAHLEALAAAAPRLLAEAPPDFRLSAISHRIAVLEEQLRQQ 313 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1144.1259.1 >prot_L-elsbetiae_contig1144.1259.1 ID=prot_L-elsbetiae_contig1144.1259.1|Name=mRNA_L-elsbetiae_contig1144.1259.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bp DLDTTNTKRPGAHAERGDVVEKCVKADSCEEPESDKHGGADALHGGSRACback to top mRNA from alignment at L-elsbetiae_contig1144:11878..12775- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1144.1259.1 ID=mRNA_L-elsbetiae_contig1144.1259.1|Name=mRNA_L-elsbetiae_contig1144.1259.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=898bp|location=Sequence derived from alignment at L-elsbetiae_contig1144:11878..12775- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1144:11878..12775- >mRNA_L-elsbetiae_contig1144.1259.1 ID=mRNA_L-elsbetiae_contig1144.1259.1|Name=mRNA_L-elsbetiae_contig1144.1259.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=672bp|location=Sequence derived from alignment at L-elsbetiae_contig1144:11878..12775- (Laminarionema elsbetiae ELsaHSoW15)back to top |