prot_L-elsbetiae_contig1144.1259.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Match: A0A6H5JCV6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCV6_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 5.330e-14 Identity = 39/53 (73.58%), Postives = 44/53 (83.02%), Query Frame = 0 Query: 60 PSAFSPTAANPLHAHLDVLAVAAPRLLGEAPPDFRLSAVSYRIAALERQLQQQ 112 PS + PT+ NPLHAHL+ LA AAP LL EAPPDFRLSA S+RIAALE QL+QQ Sbjct: 314 PSLYVPTSPNPLHAHLEALAAAAPHLLAEAPPDFRLSATSHRIAALEEQLRQQ 366
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Match: D7FKD5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKD5_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 1.000e-13 Identity = 38/52 (73.08%), Postives = 44/52 (84.62%), Query Frame = 0 Query: 61 SAFSPTAANPLHAHLDVLAVAAPRLLGEAPPDFRLSAVSYRIAALERQLQQQ 112 S + PT+ NPLHAHL+ LA AAPRLL EAPPDFRLSA+S+RIA LE QL+QQ Sbjct: 262 SLYVPTSPNPLHAHLEALAAAAPRLLAEAPPDFRLSAISHRIAVLEEQLRQQ 313 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1144.1259.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1144.1259.1 ID=prot_L-elsbetiae_contig1144.1259.1|Name=mRNA_L-elsbetiae_contig1144.1259.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bpback to top |