prot_H-elongata_contig9793.17140.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig9793.17140.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
SFGGRVLVDFSGKTPVQFPGGNMYKLIVRDDYSRRTKVYFLHGKDETAKYFMKYLVDTAPRKVEIARSDEGGEFEGEFSALCARGKIKQEFTTA102030405060708090Expect = 3.41e-20 / Id = 52.63Expect = 1.40e-19 / Id = 53.68Expect = 5.04e-19 / Id = 52.63Expect = 5.06e-19 / Id = 52.63Expect = 5.10e-19 / Id = 52.63Expect = 5.15e-19 / Id = 52.63Expect = 5.16e-19 / Id = 52.63Expect = 5.16e-19 / Id = 52.63Expect = 5.17e-19 / Id = 52.63Expect = 1.12e-18 / Id = 51.58SequenceA0A6H5J7U9_9PHAEA0A6H5L158_9PHAEA0A6H5KGN1_9PHAEA0A6H5L3E0_9PHAEA0A6H5K583_9PHAEA0A6H5JTI6_9PHAEA0A6H5JZQ8_9PHAEA0A6H5JN00_9PHAEA0A6H5KF60_9PHAEA0A6H5JYF9_9PHAE
Match NameE-valueIdentityDescription
A0A6H5J7U9_9PHAE3.410e-2052.63Integrase catalytic domain-containing protein n=1 ... [more]
A0A6H5L158_9PHAE1.400e-1953.68Integrase catalytic domain-containing protein n=1 ... [more]
A0A6H5KGN1_9PHAE5.040e-1952.63Integrase catalytic domain-containing protein n=1 ... [more]
A0A6H5L3E0_9PHAE5.060e-1952.63Integrase catalytic domain-containing protein (Fra... [more]
A0A6H5K583_9PHAE5.100e-1952.63Integrase catalytic domain-containing protein n=1 ... [more]
A0A6H5JTI6_9PHAE5.150e-1952.63Integrase catalytic domain-containing protein n=1 ... [more]
A0A6H5JZQ8_9PHAE5.160e-1952.63Uncharacterized protein n=2 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JN00_9PHAE5.160e-1952.63Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KF60_9PHAE5.170e-1952.63Uncharacterized protein n=12 Tax=Ectocarpus sp. CC... [more]
A0A6H5JYF9_9PHAE1.120e-1851.58Integrase catalytic domain-containing protein n=1 ... [more]

Pages

back to top