prot_H-akashiwo_Contig941.5.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A7S3Y3B6_HETAK (Hypothetical protein (Fragment) n=6 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y3B6_HETAK) HSP 1 Score: 62.4 bits (150), Expect = 2.200e-10 Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 LDISTAFLN DIDGDVYV+QPPGFVD +HP+K Sbjct: 224 LDISTAFLNSDIDGDVYVKQPPGFVDKDHPHK 255
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A7S3Y3C5_HETAK (Hypothetical protein (Fragment) n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y3C5_HETAK) HSP 1 Score: 62.4 bits (150), Expect = 2.210e-10 Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 LDISTAFLN DIDGDVYV+QPPGFVD +HP+K Sbjct: 295 LDISTAFLNSDIDGDVYVKQPPGFVDKDHPHK 326
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A7S3Y6S2_HETAK (Hypothetical protein (Fragment) n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y6S2_HETAK) HSP 1 Score: 57.8 bits (138), Expect = 7.380e-9 Identity = 25/32 (78.12%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 LDISTAFLNG + DVYVRQPP +VDP+HPNK Sbjct: 36 LDISTAFLNGAMTDDVYVRQPPSYVDPQHPNK 67
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A803QDY6_CANSA (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Cannabis sativa TaxID=3483 RepID=A0A803QDY6_CANSA) HSP 1 Score: 56.2 bits (134), Expect = 3.290e-8 Identity = 22/32 (68.75%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 LD++ AFLNGD+ ++Y+ QPPGFVDPEHPNK Sbjct: 128 LDVNNAFLNGDLQEEIYMVQPPGFVDPEHPNK 159
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: Q7XZY2_ORYSJ (Putative gag/pol polyprotein n=2 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=Q7XZY2_ORYSJ) HSP 1 Score: 54.3 bits (129), Expect = 1.570e-7 Identity = 22/32 (68.75%), Postives = 28/32 (87.50%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 +D+ +AFLNGD++ DVYV QPPGFVD EHP+K Sbjct: 378 MDVKSAFLNGDLEEDVYVVQPPGFVDEEHPDK 409
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A2I0V9Y1_9ASPA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=2 Tax=Dendrobium catenatum TaxID=906689 RepID=A0A2I0V9Y1_9ASPA) HSP 1 Score: 54.3 bits (129), Expect = 1.580e-7 Identity = 21/30 (70.00%), Postives = 27/30 (90.00%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHP 30 LD+S AFL+GD+ DVY+RQPPGF+DP+HP Sbjct: 21 LDVSNAFLHGDLPDDVYMRQPPGFIDPKHP 50
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A699NIQ8_TANCI (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) n=1 Tax=Tanacetum cinerariifolium TaxID=118510 RepID=A0A699NIQ8_TANCI) HSP 1 Score: 52.8 bits (125), Expect = 2.230e-7 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNKF 33 +D+ TAFLNG + +VYV QP GFVDP+HP KF Sbjct: 106 MDVKTAFLNGPLKDEVYVAQPDGFVDPDHPKKF 138
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A699R5A0_TANCI (Gag-Pol polyprotein (Fragment) n=1 Tax=Tanacetum cinerariifolium TaxID=118510 RepID=A0A699R5A0_TANCI) HSP 1 Score: 50.4 bits (119), Expect = 2.350e-7 Identity = 20/32 (62.50%), Postives = 26/32 (81.25%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 +D+ TAFLNG ++ +VYV QP GFVDP+HP K Sbjct: 1 MDVKTAFLNGPLNEEVYVAQPDGFVDPDHPEK 32
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A7H4LHK8_WHEAT (Genome assembly, chromosome: II n=1 Tax=Triticum aestivum TaxID=4565 RepID=A0A7H4LHK8_WHEAT) HSP 1 Score: 52.8 bits (125), Expect = 3.830e-7 Identity = 20/33 (60.61%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNKF 33 +D+ +AFLNG ++ +VYV QPPGF DP+HP+KF Sbjct: 1 MDVKSAFLNGKLEEEVYVAQPPGFEDPKHPDKF 33
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Match: A0A6L2JNN6_TANCI (Uncharacterized protein n=1 Tax=Tanacetum cinerariifolium TaxID=118510 RepID=A0A6L2JNN6_TANCI) HSP 1 Score: 53.1 bits (126), Expect = 3.960e-7 Identity = 22/32 (68.75%), Postives = 27/32 (84.38%), Query Frame = 0 Query: 1 LDISTAFLNGDIDGDVYVRQPPGFVDPEHPNK 32 +D+ +AFL G IDG+VYV QPPGFVDP+ PNK Sbjct: 4135 MDVKSAFLYGTIDGEVYVSQPPGFVDPKFPNK 4166 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig941.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig941.5.1 ID=prot_H-akashiwo_Contig941.5.1|Name=mRNA_H-akashiwo_Contig941.5.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=34bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|