mRNA_H-paniculata_contig955.17271.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-paniculata_contig955.17271.1 vs. uniprot
Match: A0A6H5JR01_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR01_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 1.790e-6 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 22 SAEAVGCVLHLDPTWL-DLVRHLTDHNLVDERKEGQLKEELEEYGR 156 S+ A ++H+DP WL DLVR +TDHNLVD++ E ++ +EL EYGR Sbjct: 150 SSPAQSDMIHVDPRWLIDLVRRVTDHNLVDKKNEHEILKELLEYGR 195
BLAST of mRNA_H-paniculata_contig955.17271.1 vs. uniprot
Match: D8LK68_ECTSI (LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LK68_ECTSI) HSP 1 Score: 50.4 bits (119), Expect = 1.640e-5 Identity = 23/46 (50.00%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 22 SAEAVGCVLHLDPTWL-DLVRHLTDHNLVDERKEGQLKEELEEYGR 156 S+ A ++H+DP WL +LVR +TDHNLVD++K+ ++ +EL EY R Sbjct: 1596 SSPAQSDMIHVDPRWLIELVRRVTDHNLVDKKKQNKILQELLEYDR 1641 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig955.17271.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig955.17271.1 >prot_H-paniculata_contig955.17271.1 ID=prot_H-paniculata_contig955.17271.1|Name=mRNA_H-paniculata_contig955.17271.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=68bp LLLDNSVSAEAVGCVLHLDPTWLDLVRHLTDHNLVDERKEGQLKEELEEYback to top mRNA from alignment at H-paniculata_contig955:9893..10096+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig955.17271.1 ID=mRNA_H-paniculata_contig955.17271.1|Name=mRNA_H-paniculata_contig955.17271.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=204bp|location=Sequence derived from alignment at H-paniculata_contig955:9893..10096+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig955:9893..10096+ >mRNA_H-paniculata_contig955.17271.1 ID=mRNA_H-paniculata_contig955.17271.1|Name=mRNA_H-paniculata_contig955.17271.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=408bp|location=Sequence derived from alignment at H-paniculata_contig955:9893..10096+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |