prot_H-paniculata_contig9474.17221.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9474.17221.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MAGSLMYASTGSRPDIAYAIYQAARRMEDPSREDSSTGKRIFHYLSTVPDLRITFRDKSNGHVFEGFVDTDWAGDVEDRKSTTRYVFKLNGGAISWCSRKQQLVTWSNA*102030405060708090100110Expect = 2.91e-25 / Id = 46.85Expect = 1.58e-24 / Id = 45.71Expect = 3.23e-24 / Id = 46.73Expect = 1.12e-23 / Id = 45.71Expect = 1.64e-23 / Id = 45.37Expect = 4.00e-23 / Id = 44.55Expect = 4.85e-23 / Id = 44.55Expect = 5.12e-23 / Id = 45.87Expect = 6.28e-23 / Id = 47.71Expect = 9.79e-23 / Id = 46.23SequenceA0A060SU91_PYCCIUPI0018A84BFCA0A151SR20_CAJCAUPI0018A876E3A0A329S445_9STRAA0A6A3X4P1_9STRAA0A6A3HJM7_9STRAA0A1X7SEB0_AMPQEC0SQ79_NEOYEUPI0009AB427F
Match NameE-valueIdentityDescription
A0A060SU91_PYCCI2.910e-2546.85Uncharacterized protein n=2 Tax=Pycnoporus cinnaba... [more]
UPI0018A84BFC1.580e-2445.71secreted RxLR effector protein 161-like n=1 Tax=Lu... [more]
A0A151SR20_CAJCA3.230e-2446.73Retrovirus-related Pol polyprotein from transposon... [more]
UPI0018A876E31.120e-2345.71secreted RxLR effector protein 161-like n=2 Tax=Lu... [more]
A0A329S445_9STRA1.640e-2345.37Uncharacterized protein n=2 Tax=Phytophthora cacto... [more]
A0A6A3X4P1_9STRA4.000e-2344.55Reverse transcriptase Ty1/copia-type domain-contai... [more]
A0A6A3HJM7_9STRA4.850e-2344.55Uncharacterized protein n=1 Tax=Phytophthora rubi ... [more]
A0A1X7SEB0_AMPQE5.120e-2345.87Reverse transcriptase Ty1/copia-type domain-contai... [more]
C0SQ79_NEOYE6.280e-2347.71Polyprotein n=2 Tax=Neopyropia yezoensis TaxID=278... [more]
UPI0009AB427F9.790e-2346.23uncharacterized protein LOC109950541 n=1 Tax=Prunu... [more]

Pages

back to top