prot_H-paniculata_contig12464.1544.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12464.1544.1 vs. uniprot
Match: A0A6H5KBC1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBC1_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 4.350e-10 Identity = 36/73 (49.32%), Postives = 47/73 (64.38%), Query Frame = 0 Query: 3 QAVINITK----RGLAALKDVTHLDDREANSLDLRPTP-GLQYKRITLKVLLRDEFAKADAVVQETYIYRIAA 70 ++V N T+ GL AL DVT+L +R A DL+P+P GL + R+TLK LLR EFA VQ YIYR+A+ Sbjct: 92 KSVANATRALKEEGLNALMDVTYLPERPAGHRDLQPSPDGLHFARVTLKALLRPEFAAMPGEVQAAYIYRMAS 164 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12464.1544.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig12464.1544.1 ID=prot_H-paniculata_contig12464.1544.1|Name=mRNA_H-paniculata_contig12464.1544.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=71bpback to top |