mRNA_H-paniculata_contig12044.1301.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12044.1301.1 vs. uniprot
Match: A0A6H5KPQ2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KPQ2_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 2.480e-10 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 61 PSVEVAQPKVRGNIIAGSLIGATFARSFGADGMWEGTVVK 180 P +E++ P VRG++IAG LIGATFA++FG DGMWEGTV K Sbjct: 103 PLMEMSHPHVRGSVIAGELIGATFAKNFGRDGMWEGTVTK 142
BLAST of mRNA_H-paniculata_contig12044.1301.1 vs. uniprot
Match: D8LS02_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS02_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 1.800e-9 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 61 PSVEVAQPKVRGNIIAGSLIGATFARSFGADGMWEGTVVK 180 P +E++ P VRG++IAG LIGATFA++FG DGMWEGTV K Sbjct: 204 PLMEMSHPHVRGSVIAGELIGATFAKNFGRDGMWEGTVTK 243 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12044.1301.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12044.1301.1 >prot_H-paniculata_contig12044.1301.1 ID=prot_H-paniculata_contig12044.1301.1|Name=mRNA_H-paniculata_contig12044.1301.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=60bp EIVPTTAAAVGDMQAYGLLAPSVEVAQPKVRGNIIAGSLIGATFARSFGAback to top mRNA from alignment at H-paniculata_contig12044:301..1298- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12044.1301.1 ID=mRNA_H-paniculata_contig12044.1301.1|Name=mRNA_H-paniculata_contig12044.1301.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=998bp|location=Sequence derived from alignment at H-paniculata_contig12044:301..1298- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12044:301..1298- >mRNA_H-paniculata_contig12044.1301.1 ID=mRNA_H-paniculata_contig12044.1301.1|Name=mRNA_H-paniculata_contig12044.1301.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=360bp|location=Sequence derived from alignment at H-paniculata_contig12044:301..1298- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |