Ec-28_003820.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_003820.1 vs. uniprot
Match: D7G060_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G060_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 2.040e-10 Identity = 29/37 (78.38%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 1 MMVDDGTTINGIMIDAPEQDNSGDPAGVLSHMHTLRC 111 MMVDDGTTINGIMIDAPEQDNSGDPAG + H C Sbjct: 1 MMVDDGTTINGIMIDAPEQDNSGDPAGFPATWHGPPC 37
BLAST of Ec-28_003820.1 vs. uniprot
Match: D8LTK1_ECTSI (Metacapase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTK1_ECTSI) HSP 1 Score: 48.5 bits (114), Expect = 8.920e-5 Identity = 22/26 (84.62%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 4 MVDDGTTINGIMIDAPEQDNSGDPAG 81 M DDGTTING MID PEQDNSGDP G Sbjct: 1 MEDDGTTINGTMIDGPEQDNSGDPPG 26 The following BLAST results are available for this feature:
BLAST of Ec-28_003820.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=71bpback to top spliced messenger RNA >Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=213bp|location=Sequence derived from alignment at chr_28:3691745..3692429- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGATGGTGGACGACGGCACCACCATCAACGGCATCATGATCGATGCTCCback to top protein sequence of Ec-28_003820.1 >Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=71bp MMVDDGTTINGIMIDAPEQDNSGDPAGVLSHMHTLRCRTPSLSMRVLASHback to top mRNA from alignment at chr_28:3691745..3692429- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=685bp|location=Sequence derived from alignment at chr_28:3691745..3692429- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_28:3691745..3692429- >Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=213bp|location=Sequence derived from alignment at chr_28:3691745..3692429- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-28_003820.1' has the following synonyms
|