Ec-00_006360.2 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_006360.2 vs. uniprot
Match: D7G338_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G338_ECTSI) HSP 1 Score: 124 bits (312), Expect = 9.720e-33 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1 Query: 1 MGQSQPPASRWGRYGVPFQTNWHTAVDCLVIISGIYSSIVFSHHQRTHMSKSLTRTT 171 MGQSQPPASRWGRYGVPFQTNWHTAVDCLVIISGIYSSIVFSHHQRTHMSKSLTRTT Sbjct: 1 MGQSQPPASRWGRYGVPFQTNWHTAVDCLVIISGIYSSIVFSHHQRTHMSKSLTRTT 57 The following BLAST results are available for this feature:
BLAST of Ec-00_006360.2 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_006360.2 ID=Ec-00_006360.2|Name=Ec-00_006360.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=104bpback to top spliced messenger RNA >Ec-00_006360.2 ID=Ec-00_006360.2|Name=Ec-00_006360.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=951bp|location=Sequence derived from alignment at chr_00:10053038..10054206- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGGACAATCGCAGCCGCCTGCTTCACGTTGGGGCCGCTACGGTGTGCCback to top protein sequence of Ec-00_006360.2 >Ec-00_006360.2 ID=Ec-00_006360.2|Name=Ec-00_006360.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=104bp MSLSRTSQRNKHENAYTFLNPKHTIETHIRLVYLQKTLKGKFTLSRPGGRback to top mRNA from alignment at chr_00:10053038..10054206- Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_006360.2 ID=Ec-00_006360.2|Name=Ec-00_006360.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=1169bp|location=Sequence derived from alignment at chr_00:10053038..10054206- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:10053038..10054206- >Ec-00_006360.2 ID=Ec-00_006360.2|Name=Ec-00_006360.2|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=312bp|location=Sequence derived from alignment at chr_00:10053038..10054206- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_006360.2' has the following synonyms
|