Ec-00_005480.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_005480.1 vs. uniprot
Match: D7G194_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G194_ECTSI) HSP 1 Score: 78.2 bits (191), Expect = 1.560e-18 Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 1 Query: 1 MWGTNVQAQGRQQCWTSPRSSLRSGVGSLPRRSSGAG 111 MWGTNVQAQGRQQCWTSPRSSLRSGVGSLPRRSSGAG Sbjct: 1 MWGTNVQAQGRQQCWTSPRSSLRSGVGSLPRRSSGAG 37
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5JV64_9PHAE (HTH CENPB-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV64_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 6.310e-7 Identity = 24/28 (85.71%), Postives = 25/28 (89.29%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATMLDVTEILSEKW S+QTVIRCWL Sbjct: 530 QATMLDVTEILSEKWESFSSQTVIRCWL 557
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5JEY2_9PHAE (HTH CENPB-type domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEY2_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 6.330e-7 Identity = 24/28 (85.71%), Postives = 25/28 (89.29%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATMLDVTEILSEKW S+QTVIRCWL Sbjct: 325 QATMLDVTEILSEKWESFSSQTVIRCWL 352
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5KQT9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQT9_9PHAE) HSP 1 Score: 50.1 bits (118), Expect = 5.190e-6 Identity = 22/28 (78.57%), Postives = 24/28 (85.71%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATMLDVTEILS+KW S QTV+RCWL Sbjct: 37 QATMLDVTEILSQKWESFSDQTVVRCWL 64
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5L8A7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8A7_9PHAE) HSP 1 Score: 50.1 bits (118), Expect = 5.650e-6 Identity = 22/28 (78.57%), Postives = 24/28 (85.71%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATMLDVTEILS+KW S QTV+RCWL Sbjct: 104 QATMLDVTEILSQKWESFSDQTVVRCWL 131
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5L2W8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2W8_9PHAE) HSP 1 Score: 49.3 bits (116), Expect = 8.170e-6 Identity = 22/28 (78.57%), Postives = 24/28 (85.71%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATML+VTEI S+KW RL QTVIRCWL Sbjct: 50 QATMLNVTEICSQKWRRLDVQTVIRCWL 77
BLAST of Ec-00_005480.1 vs. uniprot
Match: D8LM87_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM87_ECTSI) HSP 1 Score: 45.8 bits (107), Expect = 1.450e-5 Identity = 21/31 (67.74%), Postives = 21/31 (67.74%), Query Frame = 2 Query: 2 CGEPTCKHK--------AGNNAGRHRDPL*E 70 CGEPTCKHK AGNN GRHRDPL E Sbjct: 21 CGEPTCKHKSLLITAIRAGNNVGRHRDPLSE 51
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5KA74_9PHAE (HTH CENPB-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KA74_9PHAE) HSP 1 Score: 48.5 bits (114), Expect = 1.980e-5 Identity = 22/28 (78.57%), Postives = 23/28 (82.14%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 Q TMLDVTEILS+KW S QTVIRCWL Sbjct: 590 QPTMLDVTEILSQKWESFSDQTVIRCWL 617
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5JLK3_9PHAE (HTH CENPB-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLK3_9PHAE) HSP 1 Score: 48.1 bits (113), Expect = 2.720e-5 Identity = 21/28 (75.00%), Postives = 23/28 (82.14%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 Q TMLDVTE+LS+KW S QTVIRCWL Sbjct: 347 QPTMLDVTEVLSQKWESFSDQTVIRCWL 374
BLAST of Ec-00_005480.1 vs. uniprot
Match: A0A6H5KXD1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXD1_9PHAE) HSP 1 Score: 47.4 bits (111), Expect = 4.940e-5 Identity = 21/28 (75.00%), Postives = 22/28 (78.57%), Query Frame = 3 Query: 30 QATMLDVTEILSEKWSRLSAQTVIRCWL 113 QATMLDVTEI S+KW QTVIRCWL Sbjct: 48 QATMLDVTEICSQKWRSFDVQTVIRCWL 75 The following BLAST results are available for this feature:
BLAST of Ec-00_005480.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 14
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_005480.1 ID=Ec-00_005480.1|Name=Ec-00_005480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=38bpback to top spliced messenger RNA >Ec-00_005480.1 ID=Ec-00_005480.1|Name=Ec-00_005480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=114bp|location=Sequence derived from alignment at chr_00:8701792..8702331+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGTGGGGAACCAACGTGCAAGCACAAGGCAGGCAACAATGCTGGACGTCback to top protein sequence of Ec-00_005480.1 >Ec-00_005480.1 ID=Ec-00_005480.1|Name=Ec-00_005480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=38bp MWGTNVQAQGRQQCWTSPRSSLRSGVGSLPRRSSGAG*back to top mRNA from alignment at chr_00:8701792..8702331+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_005480.1 ID=Ec-00_005480.1|Name=Ec-00_005480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=540bp|location=Sequence derived from alignment at chr_00:8701792..8702331+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:8701792..8702331+ >Ec-00_005480.1 ID=Ec-00_005480.1|Name=Ec-00_005480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=114bp|location=Sequence derived from alignment at chr_00:8701792..8702331+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_005480.1' has the following synonyms
|