Ec-00_004250.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_004250.1 vs. uniprot
Match: D8LKZ3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LKZ3_ECTSI) HSP 1 Score: 106 bits (265), Expect = 2.660e-29 Identity = 49/54 (90.74%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 1 MDKKPHGATGGGDQDVPFEDPEDAVGFGARRLLQRLPTKTYCTAGNQRPAHGFR 162 MDK PHGATGG DQD PFEDPEDAVGFGARRLLQRLPTKT CTAGNQRPAHG R Sbjct: 1 MDKNPHGATGGDDQDAPFEDPEDAVGFGARRLLQRLPTKTCCTAGNQRPAHGLR 54
BLAST of Ec-00_004250.1 vs. uniprot
Match: D8LMM4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMM4_ECTSI) HSP 1 Score: 92.0 bits (227), Expect = 9.360e-23 Identity = 43/47 (91.49%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 MDKKPHGATGGGDQDVPFEDPEDAVGFGARRLLQRLPTKTYCTAGNQ 141 MDK PHGATGG DQD PFEDPEDAVGFGARRLLQRLPTKTY TAGNQ Sbjct: 1 MDKNPHGATGGDDQDAPFEDPEDAVGFGARRLLQRLPTKTYGTAGNQ 47
BLAST of Ec-00_004250.1 vs. uniprot
Match: D7FRZ1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRZ1_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 7.710e-14 Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 3 Query: 12 ASRCYGGGRPGRALRRPGGCCGFWSSEVAAAAANEDVLHSR 134 ASRCYG GR GRALRRPGGC GFWSSEVAA AANE+VLHSR Sbjct: 323 ASRCYGRGRLGRALRRPGGCRGFWSSEVAATAANENVLHSR 363 The following BLAST results are available for this feature:
BLAST of Ec-00_004250.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_004250.1 ID=Ec-00_004250.1|Name=Ec-00_004250.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=55bpback to top spliced messenger RNA >Ec-00_004250.1 ID=Ec-00_004250.1|Name=Ec-00_004250.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=165bp|location=Sequence derived from alignment at chr_00:5685368..5688476- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGACAAAAAGCCTCACGGTGCTACGGGGGGGGGCGACCAGGACGTGCCback to top protein sequence of Ec-00_004250.1 >Ec-00_004250.1 ID=Ec-00_004250.1|Name=Ec-00_004250.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=55bp MDKKPHGATGGGDQDVPFEDPEDAVGFGARRLLQRLPTKTYCTAGNQRPAback to top mRNA from alignment at chr_00:5685368..5688476- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_004250.1 ID=Ec-00_004250.1|Name=Ec-00_004250.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=3109bp|location=Sequence derived from alignment at chr_00:5685368..5688476- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:5685368..5688476- >Ec-00_004250.1 ID=Ec-00_004250.1|Name=Ec-00_004250.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=165bp|location=Sequence derived from alignment at chr_00:5685368..5688476- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_004250.1' has the following synonyms
|