prot_E-siliculosus-1a_F_contig1027.234.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90)
Total hits: 3
ZOOM
x 1
POSITION
0
QPGITTAADTGFVDVRVHLKKSQENLRAGLGSLGMCGAMTVYVLLFCLSHLAADTMTVASWECTIIKLGD10203040506070Expect = 2.03e-14 / Id = 88.89Expect = 1.17e-9 / Id = 77.78Expect = 1.34e-9 / Id = 92.86SequenceA0A6H5JGG7_9PHAEA0A6H5JSA2_9PHAEA0A6H5JZV7_9PHAE
Match NameE-valueIdentityDescription
A0A6H5JGG7_9PHAE2.030e-1488.89Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JSA2_9PHAE1.170e-977.78Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5JZV7_9PHAE1.340e-992.86Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
back to top