mRNA_E-siliculosus-1a_F_contig1027.234.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Match: A0A6H5JGG7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGG7_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 2.030e-14 Identity = 32/36 (88.89%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 103 MCGAMTVYVLLFCLSHLAADTMTVASWECTIIKLGD 210 MCGAM VYVLLFC SHLAADT TV SWECTIIKLGD Sbjct: 1 MCGAMAVYVLLFCFSHLAADTSTVGSWECTIIKLGD 36
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Match: A0A6H5JR50_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR50_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 1.250e-13 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = -2 Query: 78 SPNLIIVHSQDATVIVSAAR*LKQNSNTYTVIAPHMPREPSPAR 209 SPNLIIVHSQD TVIVSAAR LKQNSNTYT IAPHMP P P + Sbjct: 65 SPNLIIVHSQDPTVIVSAARLLKQNSNTYTAIAPHMP-SPEPRK 107
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Match: A0A6H5JSA2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSA2_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 1.170e-9 Identity = 28/36 (77.78%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 100 GMCGAMTVYVLLFCLSHLAADTMTVASWECTIIKLG 207 G CGAM VY LLFCLSHLAADT WECTIIKLG Sbjct: 16 GTCGAMAVYALLFCLSHLAADT-----WECTIIKLG 46
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Match: A0A6H5JZV7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZV7_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 1.340e-9 Identity = 26/28 (92.86%), Postives = 26/28 (92.86%), Query Frame = 1 Query: 118 TVYVLLFCLSHLAADTMTVASWECTIIK 201 TVYVLLFCLSHLAADTMTV SWECTII Sbjct: 7 TVYVLLFCLSHLAADTMTVGSWECTIIN 34 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig1027.234.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig1027.234.1 >prot_E-siliculosus-1a_F_contig1027.234.1 ID=prot_E-siliculosus-1a_F_contig1027.234.1|Name=mRNA_E-siliculosus-1a_F_contig1027.234.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=70bp QPGITTAADTGFVDVRVHLKKSQENLRAGLGSLGMCGAMTVYVLLFCLSHback to top mRNA from alignment at E-siliculosus-1a_F_contig1027:38256..38500+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig1027.234.1 ID=mRNA_E-siliculosus-1a_F_contig1027.234.1|Name=mRNA_E-siliculosus-1a_F_contig1027.234.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=245bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig1027:38256..38500+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig1027:38256..38500+ >mRNA_E-siliculosus-1a_F_contig1027.234.1 ID=mRNA_E-siliculosus-1a_F_contig1027.234.1|Name=mRNA_E-siliculosus-1a_F_contig1027.234.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=420bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig1027:38256..38500+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |