prot_E-siliculosus-1a_F_contig10212.200.1 (polypeptide) Ectocarpus siliculosus Ec863f_EcPH12_90f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90)
Total hits: 6
ZOOM
x 1
POSITION
0
MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK510152025303540455055Expect = 1.08e-24 / Id = 92.98Expect = 1.08e-24 / Id = 92.98Expect = 3.95e-22 / Id = 82.46Expect = 9.18e-16 / Id = 73.68Expect = 2.52e-13 / Id = 67.27Expect = 1.17e-11 / Id = 91.43SequenceD7FX56_ECTSID7FX69_ECTSIA0A6H5KZA7_9PHAED7FJV1_ECTSIA0A6H5JSC0_9PHAEA0A6H5KM38_9PHAE
Match NameE-valueIdentityDescription
D7FX56_ECTSI1.080e-2492.98LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus s... [more]
D7FX69_ECTSI1.080e-2492.98LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus s... [more]
A0A6H5KZA7_9PHAE3.950e-2282.46G domain-containing protein n=1 Tax=Ectocarpus sp.... [more]
D7FJV1_ECTSI9.180e-1673.68LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus s... [more]
A0A6H5JSC0_9PHAE2.520e-1367.27Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
A0A6H5KM38_9PHAE1.170e-1191.43Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
back to top