mRNA_E-siliculosus-1a_F_contig10212.200.1 (mRNA) Ectocarpus siliculosus Ec863f_EcPH12_90f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: D7FX56_ECTSI (LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX56_ECTSI) HSP 1 Score: 104 bits (259), Expect = 1.080e-24 Identity = 53/57 (92.98%), Postives = 55/57 (96.49%), Query Frame = 1 Query: 1 MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK 171 MIY+PV DKRTVTMHLPPSYRLALEMLEELASSSRR+AEQRTRGITRADLEEKW AK Sbjct: 648 MIYDPVDDKRTVTMHLPPSYRLALEMLEELASSSRRKAEQRTRGITRADLEEKWHAK 704
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: D7FX69_ECTSI (LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX69_ECTSI) HSP 1 Score: 104 bits (259), Expect = 1.080e-24 Identity = 53/57 (92.98%), Postives = 55/57 (96.49%), Query Frame = 1 Query: 1 MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK 171 MIY+PV DKRTVTMHLPPSYRLALEMLEELASSSRR+AEQRTRGITRADLEEKW AK Sbjct: 741 MIYDPVDDKRTVTMHLPPSYRLALEMLEELASSSRRKAEQRTRGITRADLEEKWHAK 797
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: A0A6H5KZA7_9PHAE (G domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZA7_9PHAE) HSP 1 Score: 97.1 bits (240), Expect = 3.950e-22 Identity = 47/57 (82.46%), Postives = 54/57 (94.74%), Query Frame = 1 Query: 1 MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK 171 +I+NPV DKR VTMH+PP Y++ALEMLEELASSSRR+AEQRTRGITRADLE+KWQAK Sbjct: 300 IIFNPVDDKRAVTMHIPPGYQVALEMLEELASSSRRKAEQRTRGITRADLEQKWQAK 356
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: D7FJV1_ECTSI (LRR-GTPase of the ROCO family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJV1_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 9.180e-16 Identity = 42/57 (73.68%), Postives = 46/57 (80.70%), Query Frame = 1 Query: 1 MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK 171 +IY+ D R VTM LP SYRLALEMLEELAS SR + EQ+TRGITRA LEEKWQAK Sbjct: 577 IIYDSTDDTRVVTMRLPESYRLALEMLEELASCSRSKTEQQTRGITRAILEEKWQAK 633
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: A0A6H5JSC0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSC0_9PHAE) HSP 1 Score: 72.0 bits (175), Expect = 2.520e-13 Identity = 37/55 (67.27%), Postives = 41/55 (74.55%), Query Frame = 1 Query: 7 YNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLEEKWQAK 171 YN R VTMHLP SYRLAL+MLEELAS SR + EQ RG+TRA LE+KWQ K Sbjct: 289 YNSASRTRAVTMHLPESYRLALKMLEELASCSRSKTEQHIRGVTRAILEDKWQTK 343
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Match: A0A6H5KM38_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KM38_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.170e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 1 MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSR 105 MIYNPV DKRTVTMHLPPSY +ALEMLEELASSSR Sbjct: 208 MIYNPVDDKRTVTMHLPPSYHVALEMLEELASSSR 242 The following BLAST results are available for this feature:
BLAST of mRNA_E-siliculosus-1a_F_contig10212.200.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Ectocarpus siliculosus 1a female vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_E-siliculosus-1a_F_contig10212.200.1 >prot_E-siliculosus-1a_F_contig10212.200.1 ID=prot_E-siliculosus-1a_F_contig10212.200.1|Name=mRNA_E-siliculosus-1a_F_contig10212.200.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=polypeptide|length=57bp MIYNPVVDKRTVTMHLPPSYRLALEMLEELASSSRRRAEQRTRGITRADLback to top mRNA from alignment at E-siliculosus-1a_F_contig10212:1436..1903+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_E-siliculosus-1a_F_contig10212.200.1 ID=mRNA_E-siliculosus-1a_F_contig10212.200.1|Name=mRNA_E-siliculosus-1a_F_contig10212.200.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=mRNA|length=468bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10212:1436..1903+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top Coding sequence (CDS) from alignment at E-siliculosus-1a_F_contig10212:1436..1903+ >mRNA_E-siliculosus-1a_F_contig10212.200.1 ID=mRNA_E-siliculosus-1a_F_contig10212.200.1|Name=mRNA_E-siliculosus-1a_F_contig10212.200.1|organism=Ectocarpus siliculosus Ec863f_EcPH12_90f female|type=CDS|length=342bp|location=Sequence derived from alignment at E-siliculosus-1a_F_contig10212:1436..1903+ (Ectocarpus siliculosus Ec863f_EcPH12_90f female)back to top |