prot_E_fasciculatus_S2_contig9873.17872.1 (polypeptide) Ectocarpus fasciculatus EfasUO2

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
FARKLWSGSSCRIAGGEICFFATGMTCNFSLATAMGGSRSLPELYVLQTSYSVFLPVLMFGIPVVVDFWVQSLPMHVSEQAI*1020304050607080Expect = 3.21e-26 / Id = 89.47Expect = 1.80e-25 / Id = 90.38Expect = 1.05e-16 / Id = 82.61Expect = 9.31e-5 / Id = 95.45SequenceA0A6H5JMA3_9PHAED8LSN7_ECTSID8LSN6_ECTSIA0A6H5JML4_9PHAE
Match NameE-valueIdentityDescription
A0A6H5JMA3_9PHAE3.210e-2689.47Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
D8LSN7_ECTSI1.800e-2590.38Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
D8LSN6_ECTSI1.050e-1682.61Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A6H5JML4_9PHAE9.310e-595.45Uncharacterized protein n=1 Tax=Ectocarpus sp. CCA... [more]
back to top