prot_E_fasciculatus_S2_contig9873.17872.1 (polypeptide) Ectocarpus fasciculatus EfasUO2
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Match: A0A6H5JMA3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMA3_9PHAE) HSP 1 Score: 108 bits (269), Expect = 3.210e-26 Identity = 51/57 (89.47%), Postives = 54/57 (94.74%), Query Frame = 0 Query: 20 FFATGMTCNFSLATAMGGSRSLPELYVLQTSYSVFLPVLMFGIPVVVDFWVQSLPMH 76 FFA GM CNFSLATAMGGS SLPELYVLQT+Y+VFLPVLMFGIP+VVDFWVQSLPMH Sbjct: 130 FFAAGMACNFSLATAMGGSLSLPELYVLQTNYAVFLPVLMFGIPIVVDFWVQSLPMH 186
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Match: D8LSN7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSN7_ECTSI) HSP 1 Score: 102 bits (254), Expect = 1.800e-25 Identity = 47/52 (90.38%), Postives = 51/52 (98.08%), Query Frame = 0 Query: 25 MTCNFSLATAMGGSRSLPELYVLQTSYSVFLPVLMFGIPVVVDFWVQSLPMH 76 M CNFSLATAMGGSRSLPELYVLQT+Y+VFLPVLMFGIP++VDFWVQSLPMH Sbjct: 1 MACNFSLATAMGGSRSLPELYVLQTNYAVFLPVLMFGIPIIVDFWVQSLPMH 52
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Match: D8LSN6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSN6_ECTSI) HSP 1 Score: 80.1 bits (196), Expect = 1.050e-16 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0 Query: 31 LATAMGGSRSLPELYVLQTSYSVFLPVLMFGIPVVVDFWVQSLPMH 76 L + G +RSLPELYVLQTSYSVFLPVLMFGIP+VVDFW QSLPMH Sbjct: 17 LGDSDGRNRSLPELYVLQTSYSVFLPVLMFGIPIVVDFWAQSLPMH 62
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Match: A0A6H5JML4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JML4_9PHAE) HSP 1 Score: 48.5 bits (114), Expect = 9.310e-5 Identity = 21/22 (95.45%), Postives = 22/22 (100.00%), Query Frame = 0 Query: 55 LPVLMFGIPVVVDFWVQSLPMH 76 LPVLMFGIP+VVDFWVQSLPMH Sbjct: 3 LPVLMFGIPIVVDFWVQSLPMH 24 The following BLAST results are available for this feature:
BLAST of mRNA_E_fasciculatus_S2_contig9873.17872.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Ectocarpus fasciculatus EfasUO2 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0 of Ectocarpus fasciculatus EfasUO2
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_E_fasciculatus_S2_contig9873.17872.1 ID=prot_E_fasciculatus_S2_contig9873.17872.1|Name=mRNA_E_fasciculatus_S2_contig9873.17872.1|organism=Ectocarpus fasciculatus EfasUO2|type=polypeptide|length=83bpback to top |