prot_D-mesarthrocarpus_Contig10135.3.1 (polypeptide) Discosporangium mesarthrocarpum MT17_79

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
MPSLFLTFPQACAGRVNAKGFGTCEPWFFDYLKCVDKCVSA510152025303540Expect = 1.7E-6 / Score = 30.0Score = Expect = 9.0E-7 / Score = 29.0SequenceG3DSA:1.10.287.20SSF81531PF02320
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036811Ubiquinol-cytochrome C reductase hinge domain superfamilyGENE3D1.10.287.20coord: 5..41
e-value: 1.7E-6
score: 30.0
IPR036811Ubiquinol-cytochrome C reductase hinge domain superfamilySUPERFAMILY81531Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)coord: 10..40
IPR023184Ubiquinol-cytochrome C reductase hinge domainPFAMPF02320UCR_hingecoord: 10..40
e-value: 9.0E-7
score: 29.0