mRNA_D-dudresnayi_contig982.28623.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A448ZAU0_9STRA (Tr-type G domain-containing protein n=1 Tax=Pseudo-nitzschia multistriata TaxID=183589 RepID=A0A448ZAU0_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 8.500e-8 Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 1 Query: 16 YIQGTAKVLKVYTFSGARAQV-VAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLPESRSDT--ELKRMKATVNEVENGLECGLTLSGYSDFQE 306 + G AKV +++ + +AGL V+ G + R K SD+ +R+ RNG+++ P+ S T L++ K TV V+ G ECGL LSG+SDF+E Sbjct: 956 HTHGRAKVKAIFSIDTEDGEERIAGLNVLDGNMYRAKGPAGGSDTIDLPSHFRVYRNGELISPDDESVTASSLRKFKETVESVKLGEECGLGLSGFSDFEE 1056
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A1E7ER04_9STRA (p-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7ER04_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.190e-5 Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 1 Query: 16 YIQGTAKVLKVYTFSGARA-QVVAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLP--ESRSDTELKRMKATVNEVENGLECGLTLSGYSDFQE 306 + G A V V+T + VAGL V++G + ++K S +T +R+ R+ +++ P ES + + L+R K V+ V G ECGL LSG++DF+E Sbjct: 453 HTHGRASVKAVFTIGTINGDEKVAGLNVMNGNIYKSKAPAGDSSTTDLDCHFRVYRDSQLISPVGESVTASSLRRFKELVDSVRLGDECGLALSGFTDFEE 553
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A2E6T143_9BACT (Translation initiation factor IF-2 n=2 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E6T143_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 7.900e-5 Identity = 39/97 (40.21%), Postives = 52/97 (53.61%), Query Frame = 1 Query: 19 IQGTAKVLKVYTFSGARAQVVAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLPESRSDTELKRMKATVNEVENGLECGLTLSGYSDFQE 306 + G A+V K++ S + VAG VISG++ R K R+ R G +V E S T LKR K VNEV +G+ECG+ L G+ DFQE Sbjct: 670 VTGQAEVRKIFELS--KGGNVAGCAVISGKIVRGK--------------MRVVRKGNLVY-EGISHT-LKRFKDEVNEVRSGMECGIRLDGFDDFQE 748 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig982.28623.1 >prot_D-dudresnayi_contig982.28623.1 ID=prot_D-dudresnayi_contig982.28623.1|Name=mRNA_D-dudresnayi_contig982.28623.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=102bp MLSCVYIQGTAKVLKVYTFSGARAQVVAGLQVISGRLRTKTSNSASDSTSback to top mRNA from alignment at D-dudresnayi_contig982:2018..2457- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig982.28623.1 ID=mRNA_D-dudresnayi_contig982.28623.1|Name=mRNA_D-dudresnayi_contig982.28623.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=440bp|location=Sequence derived from alignment at D-dudresnayi_contig982:2018..2457- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig982:2018..2457- >mRNA_D-dudresnayi_contig982.28623.1 ID=mRNA_D-dudresnayi_contig982.28623.1|Name=mRNA_D-dudresnayi_contig982.28623.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=612bp|location=Sequence derived from alignment at D-dudresnayi_contig982:2018..2457- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |