prot_D-dudresnayi_contig982.28623.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A448ZAU0_9STRA (Tr-type G domain-containing protein n=1 Tax=Pseudo-nitzschia multistriata TaxID=183589 RepID=A0A448ZAU0_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 8.500e-8 Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 0 Query: 6 YIQGTAKVLKVYTFSGARAQV-VAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLPESRSDT--ELKRMKATVNEVENGLECGLTLSGYSDFQE 102 + G AKV +++ + +AGL V+ G + R K SD+ +R+ RNG+++ P+ S T L++ K TV V+ G ECGL LSG+SDF+E Sbjct: 956 HTHGRAKVKAIFSIDTEDGEERIAGLNVLDGNMYRAKGPAGGSDTIDLPSHFRVYRNGELISPDDESVTASSLRKFKETVESVKLGEECGLGLSGFSDFEE 1056
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A1E7ER04_9STRA (p-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7ER04_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.190e-5 Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 0 Query: 6 YIQGTAKVLKVYTFSGARA-QVVAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLP--ESRSDTELKRMKATVNEVENGLECGLTLSGYSDFQE 102 + G A V V+T + VAGL V++G + ++K S +T +R+ R+ +++ P ES + + L+R K V+ V G ECGL LSG++DF+E Sbjct: 453 HTHGRASVKAVFTIGTINGDEKVAGLNVMNGNIYKSKAPAGDSSTTDLDCHFRVYRDSQLISPVGESVTASSLRRFKELVDSVRLGDECGLALSGFTDFEE 553
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Match: A0A2E6T143_9BACT (Translation initiation factor IF-2 n=2 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E6T143_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 7.900e-5 Identity = 39/97 (40.21%), Postives = 52/97 (53.61%), Query Frame = 0 Query: 7 IQGTAKVLKVYTFSGARAQVVAGLQVISGRL-RTKTSNSASDSTSSGYVYRITRNGKVVLPESRSDTELKRMKATVNEVENGLECGLTLSGYSDFQE 102 + G A+V K++ S + VAG VISG++ R K R+ R G +V E S T LKR K VNEV +G+ECG+ L G+ DFQE Sbjct: 670 VTGQAEVRKIFELS--KGGNVAGCAVISGKIVRGK--------------MRVVRKGNLVY-EGISHT-LKRFKDEVNEVRSGMECGIRLDGFDDFQE 748 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig982.28623.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig982.28623.1 ID=prot_D-dudresnayi_contig982.28623.1|Name=mRNA_D-dudresnayi_contig982.28623.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=102bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|