Homology
BLAST of mRNA_C-australica_Contig_1028.1.1 vs. uniprot
Match:
A0A835ZDW7_9STRA (Bromo domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZDW7_9STRA)
HSP 1 Score: 85.5 bits (210), Expect = 3.130e-16
Identity = 37/92 (40.22%), Postives = 59/92 (64.13%), Query Frame = 0
Query: 43 FDLYDGSGTEKMRILDSFALYTLDGKPVPLEALDRVKQGENFVGFGTVVEPLSDDASARLEQLENKMRGKMPSCTPREDSHTAVQLSAMKAV 134
+D+Y+ GT+K+R+LD+FALYT DGK VP E +D+VK G + +GT VE + +D R+ L +K +G+ P C P + ++ + KA+
Sbjct: 43 YDMYEAGGTDKLRLLDNFALYTHDGKMVPFEDIDKVKDGVPLIAYGTCVESICEDGRQRVSLLHSKTKGRPPPCVPIPRADSSSSTNGTKAL 134
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_1028.1.1 vs. uniprot
Analysis Date: 2022-09-16 (
Diamond blastp: OGS1.0 vs UniRef90 )
Total hits: 1
M Y L N S S S C L G R Q E A R L R D A D P L A Q G G S G A E D E E A E D G P G L H E F D L Y D G S G T E K M R I L D S F A L Y T L D G K P V P L E A L D R V K Q G E N F V G F G T V V E P L S D D A S A R L E Q L E N K M R G K M P S C T P R E D S H T A V Q L S A M K A V F G D S D D E L E G G L D S K K A R G E M Q Q G P V K T S G L K L T 20 40 60 80 100 120 140 160 Expect = 3.13e-16 / Id = 40.22 Sequence A0A835ZDW7_9STRA
Match Name E-value Identity Description
A0A835ZDW7_9STRA 3.130e-16 40.22 Bromo domain-containing protein n=1 Tax=Tribonema ... [more]
back to top
InterPro
Analysis Name:
InterProScan on OGS1.0
Date Performed: 2022-09-29
M Y L N S S S C L G R Q E A R L R D A D P L A Q G G S G A E D E E A E D G P G L H E F D L Y D G S G T E K M R I L D S F A L Y T L D G K P V P L E A L D R V K Q G E N F V G F G T V V E P L S D D A S A R L E Q L E N K M R G K M P S C T P R E D S H T A V Q L S A M K A V F G D S D D E L E G G L D S K K A R G E M Q Q G P V K T S G L K L T 20 40 60 80 100 120 140 160 Score = Score = Score = Sequence mobidb-lite mobidb-lite mobidb-lite
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 136..168 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..45 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 136..150
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>prot_C-australica_Contig_1028.1.1 ID=prot_C-australica_Contig_1028.1.1|Name=mRNA_C-australica_Contig_1028.1.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=168bp back to top