mRNA_C-australica_Contig_1028.1.1 (mRNA) Chrysoparadoxa australica CS_1217
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-australica_Contig_1028.1.1 vs. uniprot
Match: A0A835ZDW7_9STRA (Bromo domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZDW7_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 3.130e-16 Identity = 37/92 (40.22%), Postives = 59/92 (64.13%), Query Frame = 1 Query: 127 FDLYDGSGTEKMRILDSFALYTLDGKPVPLEALDRVKQGENFVGFGTVVEPLSDDASARLEQLENKMRGKMPSCTPREDSHTAVQLSAMKAV 402 +D+Y+ GT+K+R+LD+FALYT DGK VP E +D+VK G + +GT VE + +D R+ L +K +G+ P C P + ++ + KA+ Sbjct: 43 YDMYEAGGTDKLRLLDNFALYTHDGKMVPFEDIDKVKDGVPLIAYGTCVESICEDGRQRVSLLHSKTKGRPPPCVPIPRADSSSSTNGTKAL 134 The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_1028.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-australica_Contig_1028.1.1 >prot_C-australica_Contig_1028.1.1 ID=prot_C-australica_Contig_1028.1.1|Name=mRNA_C-australica_Contig_1028.1.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=168bp MYLNSSSCLGRQEARLRDADPLAQGGSGAEDEEAEDGPGLHEFDLYDGSGback to top mRNA from alignment at C-australica_Contig_1028:958..1754+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-australica_Contig_1028.1.1 ID=mRNA_C-australica_Contig_1028.1.1|Name=mRNA_C-australica_Contig_1028.1.1|organism=Chrysoparadoxa australica CS_1217|type=mRNA|length=797bp|location=Sequence derived from alignment at C-australica_Contig_1028:958..1754+ (Chrysoparadoxa australica CS_1217)back to top Coding sequence (CDS) from alignment at C-australica_Contig_1028:958..1754+ >mRNA_C-australica_Contig_1028.1.1 ID=mRNA_C-australica_Contig_1028.1.1|Name=mRNA_C-australica_Contig_1028.1.1|organism=Chrysoparadoxa australica CS_1217|type=CDS|length=504bp|location=Sequence derived from alignment at C-australica_Contig_1028:958..1754+ (Chrysoparadoxa australica CS_1217)back to top |