mRNA_C-linearis_contig104.921.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Homology
BLAST of mRNA_C-linearis_contig104.921.1 vs. uniprot
Match: D8LE97_ECTSI (Cell division cycle 123 homolog (S. cerevisiae) n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LE97_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 1.750e-9 Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = -3 Query: 610 RGPADVGMGTLMCGTGGSGGLELEDLIESCRLADNE 717
RGPADVGMGTL CGTGG+GGLELEDLIESCRLA+ +
Sbjct: 409 RGPADVGMGTLACGTGGNGGLELEDLIESCRLAEKD 444 The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig104.921.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig104.921.1 >prot_C-linearis_contig104.921.1 ID=prot_C-linearis_contig104.921.1|Name=mRNA_C-linearis_contig104.921.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=144bp KCSTLNTPQRVVHVSPWSERDCRQTKWDENTHTHTHIQHGPAQRTDRCVRback to top mRNA from alignment at C-linearis_contig104:526590..527308+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig104.921.1 ID=mRNA_C-linearis_contig104.921.1|Name=mRNA_C-linearis_contig104.921.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=719bp|location=Sequence derived from alignment at C-linearis_contig104:526590..527308+ (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig104:526590..527308+ >mRNA_C-linearis_contig104.921.1 ID=mRNA_C-linearis_contig104.921.1|Name=mRNA_C-linearis_contig104.921.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=864bp|location=Sequence derived from alignment at C-linearis_contig104:526590..527308+ (Chordaria linearis ClinC8C monoicous)back to top |