mRNA_1498 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|129861 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_1498 ID=mRNA_1498|Name=jgi.p|Trimin1|129861|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=498bp|location=Sequence derived from alignment at Contig_18:1251967..1252464- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. GGAAAATGTCCGCATGGTAGACAGCAGAGCCAGTGTAAGGAGTGCGGAGGback to top protein sequence of jgi.p|Trimin1|129861 >Trimin1|129861|gw1.18.18.1 ID=Trimin1|129861|gw1.18.18.1|Name=jgi.p|Trimin1|129861|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=166bp GKCPHGRQQSQCKECGGKGVCPHGRLRHRCKPCGGASICVHQKMRDTCREback to top mRNA from alignment at Contig_18:1251967..1252464- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_1498 ID=mRNA_1498|Name=jgi.p|Trimin1|129861|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=498bp|location=Sequence derived from alignment at Contig_18:1251967..1252464- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_18:1251967..1252464- >mRNA_1498 ID=mRNA_1498|Name=jgi.p|Trimin1|129861|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=498bp|location=Sequence derived from alignment at Contig_18:1251967..1252464- (Tribonema minus UTEX_B_3156 )back to top |