Trimin1|336498|MIX45261_8_87 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|336498 vs. uniprot
Match: A0A835YIM3_9STRA (Uncharacterized protein n=3 Tax=Tribonema minus TaxID=303371 RepID=A0A835YIM3_9STRA) HSP 1 Score: 103 bits (257), Expect = 6.150e-28 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0 Query: 1 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP 53 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP Sbjct: 21 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP 73
BLAST of jgi.p|Trimin1|336498 vs. uniprot
Match: D7FKG2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKG2_ECTSI) HSP 1 Score: 47.8 bits (112), Expect = 1.650e-5 Identity = 21/42 (50.00%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 4 ATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLG 45 AT LR+ AD MV +TGA++ + ++P+IDEI LK++Y+ V+G Sbjct: 46 ATVLREKADEMVAETGAINFEIIQPMIDEIAVLKSKYKVVMG 87 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|336498 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|336498|MIX45261_8_87 ID=Trimin1|336498|MIX45261_8_87|Name=jgi.p|Trimin1|336498|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=54bpback to top |