mRNA_7254 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|131714 vs. uniprot
Match: A0A835YQZ4_9STRA (Phorbol-ester/DAG-type domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YQZ4_9STRA) HSP 1 Score: 160 bits (404), Expect = 7.190e-50 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1 Query: 1 VPAQVSYAPTAIAAVATHGHSYQPCLLQLPCRCAACGETAWGALGLSRVCICLTCGVRVHRQCARSAAVPRCAARAEF 234 VPAQVSYAPTAIAAVATHGHSYQPCLLQLPCRCAACGETAWGALGLSRVCICLTCGVRVHRQCARSAAVPRCAARAEF Sbjct: 1 VPAQVSYAPTAIAAVATHGHSYQPCLLQLPCRCAACGETAWGALGLSRVCICLTCGVRVHRQCARSAAVPRCAARAEF 78 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|131714 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_7254 ID=mRNA_7254|Name=jgi.p|Trimin1|131714|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=234bp|location=Sequence derived from alignment at Contig_55:149396..149629+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. GTGCCCGCGCAGGTGAGCTACGCGCCCACCGCCATCGCCGCCGTCGCAACback to top protein sequence of jgi.p|Trimin1|131714 >Trimin1|131714|gw1.55.11.1 ID=Trimin1|131714|gw1.55.11.1|Name=jgi.p|Trimin1|131714|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=78bp VPAQVSYAPTAIAAVATHGHSYQPCLLQLPCRCAACGETAWGALGLSRVCback to top mRNA from alignment at Contig_55:149396..149629+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_7254 ID=mRNA_7254|Name=jgi.p|Trimin1|131714|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=234bp|location=Sequence derived from alignment at Contig_55:149396..149629+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_55:149396..149629+ >mRNA_7254 ID=mRNA_7254|Name=jgi.p|Trimin1|131714|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=234bp|location=Sequence derived from alignment at Contig_55:149396..149629+ (Tribonema minus UTEX_B_3156 )back to top |