mRNA_1928 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|130134 vs. uniprot
Match: A0A835Z5N9_9STRA (Ankyrin repeat-containing domain protein (Fragment) n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z5N9_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 7.790e-13 Identity = 35/36 (97.22%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 4 DGTTALHHATARGDAEAVSILLTAGANPRLRTQFGQ 111 DGTTALHHATARGDAEAVSILL AGANPRLRTQFGQ Sbjct: 1 DGTTALHHATARGDAEAVSILLAAGANPRLRTQFGQ 36 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|130134 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_1928 ID=mRNA_1928|Name=jgi.p|Trimin1|130134|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=420bp|location=Sequence derived from alignment at Contig_26:535904..536323- (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. GAGGACGGGACCACTGCTCTTCACCATGCCACAGCTCGTGGTGATGCTGAback to top protein sequence of jgi.p|Trimin1|130134 >Trimin1|130134|gw1.26.15.1 ID=Trimin1|130134|gw1.26.15.1|Name=jgi.p|Trimin1|130134|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=140bp EDGTTALHHATARGDAEAVSILLTAGANPRLRTQFGQTPLHFASLAKNTIback to top mRNA from alignment at Contig_26:535904..536323- Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_1928 ID=mRNA_1928|Name=jgi.p|Trimin1|130134|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=420bp|location=Sequence derived from alignment at Contig_26:535904..536323- (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_26:535904..536323- >mRNA_1928 ID=mRNA_1928|Name=jgi.p|Trimin1|130134|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=420bp|location=Sequence derived from alignment at Contig_26:535904..536323- (Tribonema minus UTEX_B_3156 )back to top |