mRNA_15774 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|179866 vs. uniprot
Match: A0A836CHN8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CHN8_9STRA) HSP 1 Score: 100 bits (250), Expect = 2.800e-23 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 1 PTFGEARGAPCTHCVHHKTPEMVRTRGAFCAGNNGTCDTQPK 126 PTFGEARGAPCTHCVHHKTPEMVRTRGAFCAGNNGTCDTQPK Sbjct: 1 PTFGEARGAPCTHCVHHKTPEMVRTRGAFCAGNNGTCDTQPK 42 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|179866 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_15774 ID=mRNA_15774|Name=jgi.p|Trimin1|179866|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=579bp|location=Sequence derived from alignment at Contig_203:192144..192722+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CCGACCTTCGGCGAGGCCAGGGGGGCGCCCTGCACGCACTGCGTCCACCAback to top protein sequence of jgi.p|Trimin1|179866 >Trimin1|179866|e_gw1.203.16.1 ID=Trimin1|179866|e_gw1.203.16.1|Name=jgi.p|Trimin1|179866|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=193bp PTFGEARGAPCTHCVHHKTPEMVRTRGAFCAGNNGTCDTQPKFGAARGAPback to top mRNA from alignment at Contig_203:192144..192722+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_15774 ID=mRNA_15774|Name=jgi.p|Trimin1|179866|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=579bp|location=Sequence derived from alignment at Contig_203:192144..192722+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_203:192144..192722+ >mRNA_15774 ID=mRNA_15774|Name=jgi.p|Trimin1|179866|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=579bp|location=Sequence derived from alignment at Contig_203:192144..192722+ (Tribonema minus UTEX_B_3156 )back to top |