mRNA_1463 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Match: A0A835Z7J4_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z7J4_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 2.990e-18 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 1 Query: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 114 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN Sbjct: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 38
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Match: A0A836CFL9_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CFL9_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 1.290e-11 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 114 MEHVT + CELCRK+PSFGREW QP RCSDHKEDDM++ Sbjct: 51 MEHVTGKHCELCRKQPSFGREWHQPLRCSDHKEDDMED 88 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_1463 ID=mRNA_1463|Name=jgi.p|Trimin1|161795|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=537bp|location=Sequence derived from alignment at Contig_18:1120043..1120579+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGGAGCATGTGACCAAAAGGCAGTGTGAGCTTTGCCGCAAGAAGCCCAGback to top protein sequence of jgi.p|Trimin1|161795 >Trimin1|161795|e_gw1.18.85.1 ID=Trimin1|161795|e_gw1.18.85.1|Name=jgi.p|Trimin1|161795|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=179bp MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDNVVSKRCEFCSKQback to top mRNA from alignment at Contig_18:1120043..1120579+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_1463 ID=mRNA_1463|Name=jgi.p|Trimin1|161795|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=537bp|location=Sequence derived from alignment at Contig_18:1120043..1120579+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_18:1120043..1120579+ >mRNA_1463 ID=mRNA_1463|Name=jgi.p|Trimin1|161795|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=537bp|location=Sequence derived from alignment at Contig_18:1120043..1120579+ (Tribonema minus UTEX_B_3156 )back to top |