mRNA_13945 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|13256 vs. uniprot
Match: A0A835ZAL7_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZAL7_9STRA) HSP 1 Score: 141 bits (356), Expect = 3.200e-42 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2 Query: 35 MWLRTRLCSHLLPFCKLVYSRQPEAASKLYLGLSRYRTLVSRLQLSGCCGLSHSLQEASSTTSTSTKSRRR 247 MWLRTRLCSHLLPFCKLVYSRQPEAASKLYLGLSRYRTLVSRLQLSGCCGLSHSLQEASSTTSTSTKSRRR Sbjct: 1 MWLRTRLCSHLLPFCKLVYSRQPEAASKLYLGLSRYRTLVSRLQLSGCCGLSHSLQEASSTTSTSTKSRRR 71 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|13256 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_13945 ID=mRNA_13945|Name=jgi.p|Trimin1|13256|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=306bp|location=Sequence derived from alignment at Contig_122:356663..356968+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. CAAAGCTGGCACTACAGTAACTACTGGTAGTAGTATGTGGCTGCGCACGCback to top protein sequence of jgi.p|Trimin1|13256 >Trimin1|13256|CE13255_4 ID=Trimin1|13256|CE13255_4|Name=jgi.p|Trimin1|13256|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=72bp MWLRTRLCSHLLPFCKLVYSRQPEAASKLYLGLSRYRTLVSRLQLSGCCGback to top mRNA from alignment at Contig_122:356663..356968+ Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_13945 ID=mRNA_13945|Name=jgi.p|Trimin1|13256|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=306bp|location=Sequence derived from alignment at Contig_122:356663..356968+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_122:356663..356968+ >mRNA_13945 ID=mRNA_13945|Name=jgi.p|Trimin1|13256|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=216bp|location=Sequence derived from alignment at Contig_122:356663..356968+ (Tribonema minus UTEX_B_3156 )back to top |