mRNA_12087 (mRNA) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|351228 vs. uniprot
Match: A0A835YT28_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YT28_9STRA) HSP 1 Score: 115 bits (288), Expect = 2.440e-31 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1 Query: 205 MVAVPPLRCIYSCAHSSGGTASFSSQNILGTVARAHSRCAGSCRVSCQTEGNSDT 369 MVAVPPLRCIYSCAHSSGGTASFSSQNILGTVARAHSRCAGSCRVSCQTEGNSDT Sbjct: 1 MVAVPPLRCIYSCAHSSGGTASFSSQNILGTVARAHSRCAGSCRVSCQTEGNSDT 55
BLAST of jgi.p|Trimin1|351228 vs. uniprot
Match: A0A835YIM3_9STRA (Uncharacterized protein n=3 Tax=Tribonema minus TaxID=303371 RepID=A0A835YIM3_9STRA) HSP 1 Score: 103 bits (257), Expect = 2.000e-26 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1 Query: 1 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP 159 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP Sbjct: 21 MSKATALRDLADSMVEQTGAVDEKQLRPLIDEIGELKTQYRAVLGGVVRSNAP 73 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|351228 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >mRNA_12087 ID=mRNA_12087|Name=jgi.p|Trimin1|351228|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=434bp|location=Sequence derived from alignment at Contig_84:24585..25608+ (Tribonema minus UTEX_B_3156 )|Notes=Excludes all bases but those of type(s): exon. ATGTCAAAGGCGACGGCGCTGCGCGATCTGGCGGATTCAATGGTGGAGCAback to top protein sequence of jgi.p|Trimin1|351228 >Trimin1|351228|estExt_Genemark1.C_Ctg_840008 ID=Trimin1|351228|estExt_Genemark1.C_Ctg_840008|Name=jgi.p|Trimin1|351228|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=56bp MVAVPPLRCIYSCAHSSGGTASFSSQNILGTVARAHSRCAGSCRVSCQTEback to top mRNA from alignment at Contig_84:24585..25608+ Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_12087 ID=mRNA_12087|Name=jgi.p|Trimin1|351228|organism=Tribonema minus UTEX_B_3156 |type=mRNA|length=1024bp|location=Sequence derived from alignment at Contig_84:24585..25608+ (Tribonema minus UTEX_B_3156 )back to top Coding sequence (CDS) from alignment at Contig_84:24585..25608+ >mRNA_12087 ID=mRNA_12087|Name=jgi.p|Trimin1|351228|organism=Tribonema minus UTEX_B_3156 |type=CDS|length=168bp|location=Sequence derived from alignment at Contig_84:24585..25608+ (Tribonema minus UTEX_B_3156 )back to top |