mRNA_S-firma_F_contig10066.136.1 (mRNA) Sphaerotrichia firma ET2_F female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A2U8E0D4_9BACT (Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E0D4_9BACT) HSP 1 Score: 57.4 bits (137), Expect = 1.200e-7 Identity = 30/70 (42.86%), Postives = 46/70 (65.71%), Query Frame = 2 Query: 47 VATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 256 +AT+ V+ S TF I S+PSDNTP+KV+IT+ +L A ++ +PA+ +A+L A V NT++Y L Sbjct: 368 IATASVDASTTSATFKILAATSIPSDNTPQKVSITVNKLDAKLQYQATPAMQETAFLSAYVTNTTEYPFL 437
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A0B7AAG8_9EUPU (Uncharacterized protein n=3 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7AAG8_9EUPU) HSP 1 Score: 56.6 bits (135), Expect = 2.250e-7 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 2 Query: 29 PAPTAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 256 P P V +V + STT+ I R+++VPSD T KVT+ I +L T + T P V A+LQA V+NTS YTLL Sbjct: 350 PVPIMPVPEVQVTESTTSTTYEIARLSTVPSDYTEHKVTVAIIDLKPTLTYVTVPKVVPHAFLQAKVINTSQYTLL 425
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: UPI00065B9BF0 (protein F37C4.5 isoform X1 n=2 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B9BF0) HSP 1 Score: 55.8 bits (133), Expect = 4.180e-7 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 2 Query: 59 RVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLLP 259 ++++ S ++ I R +S+PSDNT KVT+ I EL T + + P V A+LQA VVNTS +TLLP Sbjct: 338 KIQETTVSASYEIVRQSSIPSDNTSHKVTVGIMELKPTMTYVSIPKVVPHAFLQAKVVNTSKFTLLP 404
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A139SQL2_9BACT (Uncharacterized protein n=2 Tax=Cephaloticoccus primus TaxID=1548207 RepID=A0A139SQL2_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 1.070e-6 Identity = 29/74 (39.19%), Postives = 49/74 (66.22%), Query Frame = 2 Query: 38 TAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLLP 259 +A A ++V++ A+ TF ++ A++PSDN+ KK+++T +L A + +P +A+L A+V NTSDY LLP Sbjct: 346 SADYAEAQVDRSASVATFQVEAPATIPSDNSAKKISVTTLDLEAELAYRATPKRLPTAFLDASVRNTSDYPLLP 419
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A3E1E6D4_9BACT (Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A3E1E6D4_9BACT) HSP 1 Score: 54.3 bits (129), Expect = 1.460e-6 Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 2 Query: 41 AGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 256 A +A + +E GA S +F I ASVPSDN+P+KV I + LAA + T P +A+L A VVNTS++ LL Sbjct: 337 AEMAVAMIETGATSASFKIATSASVPSDNSPQKVPIMSERLAAKPEYLTVPKRLTTAFLTAKVVNTSEFPLL 408
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A2U8E4K2_9BACT (Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E4K2_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 7.000e-6 Identity = 29/73 (39.73%), Postives = 47/73 (64.38%), Query Frame = 2 Query: 38 TAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 256 T+ A ++V+ S +F I S+PSDNTP+KV+IT +L A ++ + PA+ +AYL A V N++++ LL Sbjct: 378 TSDYAVAKVDNTTTSASFKIAAATSIPSDNTPQKVSITTAKLGAKLQYQSLPALQETAYLSAYVDNSTEFPLL 450 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_F_contig10066.136.1 >prot_S-firma_F_contig10066.136.1 ID=prot_S-firma_F_contig10066.136.1|Name=mRNA_S-firma_F_contig10066.136.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=87bp MPPGAPRPPPAPTAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITback to top mRNA from alignment at S-firma_F_contig10066:3825..4140+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_F_contig10066.136.1 ID=mRNA_S-firma_F_contig10066.136.1|Name=mRNA_S-firma_F_contig10066.136.1|organism=Sphaerotrichia firma ET2_F female|type=mRNA|length=316bp|location=Sequence derived from alignment at S-firma_F_contig10066:3825..4140+ (Sphaerotrichia firma ET2_F female)back to top Coding sequence (CDS) from alignment at S-firma_F_contig10066:3825..4140+ >mRNA_S-firma_F_contig10066.136.1 ID=mRNA_S-firma_F_contig10066.136.1|Name=mRNA_S-firma_F_contig10066.136.1|organism=Sphaerotrichia firma ET2_F female|type=CDS|length=522bp|location=Sequence derived from alignment at S-firma_F_contig10066:3825..4140+ (Sphaerotrichia firma ET2_F female)back to top |