prot_S-firma_F_contig10066.136.1 (polypeptide) Sphaerotrichia firma ET2_F female
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A2U8E0D4_9BACT (Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E0D4_9BACT) HSP 1 Score: 57.4 bits (137), Expect = 1.200e-7 Identity = 30/70 (42.86%), Postives = 46/70 (65.71%), Query Frame = 0 Query: 16 VATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 85 +AT+ V+ S TF I S+PSDNTP+KV+IT+ +L A ++ +PA+ +A+L A V NT++Y L Sbjct: 368 IATASVDASTTSATFKILAATSIPSDNTPQKVSITVNKLDAKLQYQATPAMQETAFLSAYVTNTTEYPFL 437
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A0B7AAG8_9EUPU (Uncharacterized protein n=3 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7AAG8_9EUPU) HSP 1 Score: 56.6 bits (135), Expect = 2.250e-7 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 0 Query: 10 PAPTAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 85 P P V +V + STT+ I R+++VPSD T KVT+ I +L T + T P V A+LQA V+NTS YTLL Sbjct: 350 PVPIMPVPEVQVTESTTSTTYEIARLSTVPSDYTEHKVTVAIIDLKPTLTYVTVPKVVPHAFLQAKVINTSQYTLL 425
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: UPI00065B9BF0 (protein F37C4.5 isoform X1 n=2 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B9BF0) HSP 1 Score: 55.8 bits (133), Expect = 4.180e-7 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 20 RVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLLP 86 ++++ S ++ I R +S+PSDNT KVT+ I EL T + + P V A+LQA VVNTS +TLLP Sbjct: 338 KIQETTVSASYEIVRQSSIPSDNTSHKVTVGIMELKPTMTYVSIPKVVPHAFLQAKVVNTSKFTLLP 404
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A139SQL2_9BACT (Uncharacterized protein n=2 Tax=Cephaloticoccus primus TaxID=1548207 RepID=A0A139SQL2_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 1.070e-6 Identity = 29/74 (39.19%), Postives = 49/74 (66.22%), Query Frame = 0 Query: 13 TAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLLP 86 +A A ++V++ A+ TF ++ A++PSDN+ KK+++T +L A + +P +A+L A+V NTSDY LLP Sbjct: 346 SADYAEAQVDRSASVATFQVEAPATIPSDNSAKKISVTTLDLEAELAYRATPKRLPTAFLDASVRNTSDYPLLP 419
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A3E1E6D4_9BACT (Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A3E1E6D4_9BACT) HSP 1 Score: 54.3 bits (129), Expect = 1.460e-6 Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 0 Query: 14 AGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 85 A +A + +E GA S +F I ASVPSDN+P+KV I + LAA + T P +A+L A VVNTS++ LL Sbjct: 337 AEMAVAMIETGATSASFKIATSASVPSDNSPQKVPIMSERLAAKPEYLTVPKRLTTAFLTAKVVNTSEFPLL 408
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Match: A0A2U8E4K2_9BACT (Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E4K2_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 7.000e-6 Identity = 29/73 (39.73%), Postives = 47/73 (64.38%), Query Frame = 0 Query: 13 TAGVATSRVEKGAASTTFLIDRVASVPSDNTPKKVTITIQELAATFRFSTSPAVAASAYLQANVVNTSDYTLL 85 T+ A ++V+ S +F I S+PSDNTP+KV+IT +L A ++ + PA+ +AYL A V N++++ LL Sbjct: 378 TSDYAVAKVDNTTTSASFKIAAATSIPSDNTPQKVSITTAKLGAKLQYQSLPALQETAYLSAYVDNSTEFPLL 450 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig10066.136.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0 of Sphaerotrichia firma female
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_S-firma_F_contig10066.136.1 ID=prot_S-firma_F_contig10066.136.1|Name=mRNA_S-firma_F_contig10066.136.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=87bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|