mRNA_P-wetherbeei_contig1038.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: A0A6H5JDQ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDQ5_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 1.940e-17 Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 2 Query: 38 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNAP 283 MAKSIRSKVKK+NR E R+ VGDP++++LQAR + ++KS+ F +G+ + KLK ML + NPP E ++ F FRHP+AP Sbjct: 1 MAKSIRSKVKKRNRTEMRKNVGDPHQRKLQARCTAKIQKSVAFSAGESVTKLKGMLTAAQAANPPSKEVSKSGFSFRHPDAP 82
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: D7G0M3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0M3_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 2.260e-17 Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 2 Query: 38 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNAP 283 MAKSIRSKVKK+NR E R+ VGDP++++LQAR + ++KS+ F +G+ + KLK ML + NPP E ++ F FRHP+AP Sbjct: 1 MAKSIRSKVKKRNRTEMRKNVGDPHQRKLQARCTAKIQKSVAFSAGESVTKLKGMLTAAQAANPPSKEVSKSGFSFRHPDAP 82
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Match: A0A835Z2D3_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z2D3_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 1.040e-13 Identity = 37/81 (45.68%), Postives = 60/81 (74.07%), Query Frame = 2 Query: 38 MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDKLKSMLATEEVHNPPVPETARHAFVFRHPNA 280 MAKSIRSKVKK+NRA+ R+ G+P+ +++QA+ + L++++++ SG GI+KLK +L + NP PE ++H+ F+HP A Sbjct: 1 MAKSIRSKVKKRNRADMRKQYGEPHAQQIQAKCTARLQETVQYHSGPGINKLKGLLNKAQAENPLQPEVSKHSHTFKHPYA 81 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1038.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1038.2.1 >prot_P-wetherbeei_contig1038.2.1 ID=prot_P-wetherbeei_contig1038.2.1|Name=mRNA_P-wetherbeei_contig1038.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=186bp MAKSIRSKVKKKNRAEQRRLVGDPNRKRLQARSVSTLRKSLRFKSGDGIDback to top mRNA from alignment at P-wetherbeei_contig1038:6722..8076+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1038.2.1 ID=mRNA_P-wetherbeei_contig1038.2.1|Name=mRNA_P-wetherbeei_contig1038.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1355bp|location=Sequence derived from alignment at P-wetherbeei_contig1038:6722..8076+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1038:6722..8076+ >mRNA_P-wetherbeei_contig1038.2.1 ID=mRNA_P-wetherbeei_contig1038.2.1|Name=mRNA_P-wetherbeei_contig1038.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=558bp|location=Sequence derived from alignment at P-wetherbeei_contig1038:6722..8076+ (Phaeothamnion wetherbeei SAG_119_79)back to top |