mRNA_P-wetherbeei_contig10200.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: D7G3M9_ECTSI (NUC153 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G3M9_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 5.340e-23 Identity = 45/61 (73.77%), Postives = 56/61 (91.80%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P WLSE+++R+L+KDVEY+RRIELLQDFDFP ASQ+V VSPD Q+V+V GTYPPQ+K Sbjct: 20 GKTLPQWLSEKKRRSLSKDVEYRRRIELLQDFDFPTASQKVCVSPDAQYVIVAGTYPPQIK 80
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A835Z278_9STRA (WD40-repeat-containing domain protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z278_9STRA) HSP 1 Score: 97.8 bits (242), Expect = 2.540e-22 Identity = 44/61 (72.13%), Postives = 55/61 (90.16%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P WL+++QKR L+KD Y+RRIELLQDF+FP ASQ +++SPDGQFV+VTGTYPPQVK Sbjct: 37 GKTLPQWLNDKQKRALSKDDGYRRRIELLQDFEFPTASQTIKMSPDGQFVIVTGTYPPQVK 97
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A2R5GXA8_9STRA (Nucleolar protein 10 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GXA8_9STRA) HSP 1 Score: 91.3 bits (225), Expect = 5.060e-20 Identity = 40/61 (65.57%), Postives = 54/61 (88.52%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P W+S++ +++LAKD EY+RRIEL+QDF FPA S RV+VSPDG+++V TG+YPPQVK Sbjct: 17 GKTLPQWISDKNRKSLAKDEEYRRRIELVQDFYFPATSGRVKVSPDGEYIVATGSYPPQVK 77
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A2D4BFA0_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BFA0_PYTIN) HSP 1 Score: 88.2 bits (217), Expect = 6.180e-19 Identity = 37/61 (60.66%), Postives = 51/61 (83.61%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P WL+E+ K+ L+KD +Y+RR+ELLQDF FP+ SQRV++SPDG +++ TG YPP VK Sbjct: 2414 GKTLPQWLAEKTKKALSKDEDYRRRVELLQDFHFPSGSQRVKMSPDGNYIIATGMYPPSVK 2474
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A024G7Q4_9STRA (NUC153 domain-containing protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024G7Q4_9STRA) HSP 1 Score: 87.8 bits (216), Expect = 8.350e-19 Identity = 40/61 (65.57%), Postives = 49/61 (80.33%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT P WLSE+ KR+LAKD EY+ R+ELLQDF FP+ +QR+++SPD FVV TG YPP VK Sbjct: 20 GKTFPQWLSEKTKRSLAKDEEYRNRVELLQDFHFPSGTQRIKMSPDQNFVVATGMYPPSVK 80
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: W7TBN4_9STRA (Nucleolar protein 10 n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TBN4_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 1.560e-18 Identity = 38/61 (62.30%), Postives = 51/61 (83.61%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GK VP WLSE+ +R L+K+ +Y+RR+EL+QD +FP ASQR+RVSPDGQF+V +G YPP V+ Sbjct: 20 GKAVPQWLSEKHRRQLSKEEDYRRRVELIQDLEFPTASQRLRVSPDGQFLVASGMYPPAVR 80
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A3M6VIN9_9STRA (NUC153 domain-containing protein n=2 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VIN9_9STRA) HSP 1 Score: 86.7 bits (213), Expect = 2.130e-18 Identity = 42/63 (66.67%), Postives = 51/63 (80.95%), Query Frame = 1 Query: 1 GKTVPHWLSEQ--QKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P WL+E+ ++ LAKD +Y+RR+ELLQDF FPAASQRVR+S DG FVV TG YPP VK Sbjct: 20 GKTLPQWLNEKGGSRKALAKDEDYRRRVELLQDFHFPAASQRVRMSADGNFVVATGVYPPSVK 82
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A4D9D2Q4_9STRA (Uncharacterized protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D2Q4_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 3.900e-18 Identity = 37/61 (60.66%), Postives = 51/61 (83.61%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GK VP WLSE+ +R L+K+ +Y+RR+EL+QD +FP ASQR+RVSPDG+F+V +G YPP V+ Sbjct: 20 GKAVPQWLSEKHRRQLSKEEDYRRRVELIQDLEFPTASQRLRVSPDGRFLVASGMYPPAVR 80
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: W4GCA3_9STRA (NUC153 domain-containing protein n=5 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GCA3_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 5.420e-18 Identity = 35/61 (57.38%), Postives = 50/61 (81.97%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P W++++ +R L++D +YQRR+ELLQDF FP +SQRV +SPDG +V+ GTYPP +K Sbjct: 20 GKTLPQWIAQKTRRALSRDEDYQRRLELLQDFHFPVSSQRVTMSPDGHYVIAAGTYPPSIK 80
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Match: A0A485KJT6_9STRA (Aste57867_8214 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KJT6_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 1.010e-17 Identity = 35/61 (57.38%), Postives = 51/61 (83.61%), Query Frame = 1 Query: 1 GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVVVTGTYPPQVK 183 GKT+P WL+++ ++ L++D +Y+RR+ELLQDF FP +SQRV +SPDG +V+ TGTYPP +K Sbjct: 21 GKTLPQWLAQKTRKALSRDEDYRRRLELLQDFHFPVSSQRVTMSPDGHYVIATGTYPPSLK 81 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10200.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10200.1.1 >prot_P-wetherbeei_contig10200.1.1 ID=prot_P-wetherbeei_contig10200.1.1|Name=mRNA_P-wetherbeei_contig10200.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=61bp GKTVPHWLSEQQKRTLAKDVEYQRRIELLQDFDFPAASQRVRVSPDGQFVback to top mRNA from alignment at P-wetherbeei_contig10200:228..410- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10200.1.1 ID=mRNA_P-wetherbeei_contig10200.1.1|Name=mRNA_P-wetherbeei_contig10200.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=183bp|location=Sequence derived from alignment at P-wetherbeei_contig10200:228..410- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10200:228..410- >mRNA_P-wetherbeei_contig10200.1.1 ID=mRNA_P-wetherbeei_contig10200.1.1|Name=mRNA_P-wetherbeei_contig10200.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=183bp|location=Sequence derived from alignment at P-wetherbeei_contig10200:228..410- (Phaeothamnion wetherbeei SAG_119_79)back to top |