prot_P-wetherbeei_contig12015.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12015.1.1 vs. uniprot
Match: R7T7R2_CAPTE (Phosphatidate phosphatase n=1 Tax=Capitella teleta TaxID=283909 RepID=R7T7R2_CAPTE) HSP 1 Score: 53.5 bits (127), Expect = 5.720e-6 Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 0 Query: 10 VPGGPVLCTPEALLPRAHAPAPEAQ-KAFVTAALRGLAELFPQDANPLYAGFGSDAGQAAVLRRCGVPEGRVFACQG-GELRGGANRTFR 97 +P GP+L +P +L+ H E + + F + L+ +A LFP+ ANP YAGFG+ R G+P RVF GEL+ + TF+ Sbjct: 664 LPEGPLLLSPSSLMSAFHKEVIERKPEEFKISCLKNIAALFPESANPFYAGFGNKINDTWAYRAVGIPISRVFTVNHRGELKMEFHTTFQ 753 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12015.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12015.1.1 ID=prot_P-wetherbeei_contig12015.1.1|Name=mRNA_P-wetherbeei_contig12015.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=107bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|