prot_P-wetherbeei_contig10134.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10134.1.1 vs. uniprot
Match: A0A7Z9PVL7_9BACT (Uncharacterized protein n=1 Tax=Phycisphaerales bacterium TaxID=2052180 RepID=A0A7Z9PVL7_9BACT) HSP 1 Score: 66.2 bits (160), Expect = 3.140e-11 Identity = 40/134 (29.85%), Postives = 77/134 (57.46%), Query Frame = 0 Query: 5 LNRAGLSLLEVMLAIALMGVVVVGILVVMGGGLRLMNQAGDVTRARELATQEMENIRQSAYAYSPDGTNFDARSGTAAVG--GYPPAPYNPAP--GETYKLAVAVQRVNPTLRSIRVDVYWGVNHNIHLETLMN 134 ++ G+ LLE+++A+ ++ V ++G++ GL++MN++ ++ A E+ +E ++ + Y + GT +D G A G G+PPAPY + Y L V +V+P +R + VDV+W + L+TL++ Sbjct: 1 MSTKGVFLLEIIIALGVVVVAILGLMAAFTAGLKMMNESEKISAATEIGRSFVEQVKTTGYDKTTVGT-YDGWIGEPADGTTGFPPAPYPQVKKQDQDYWLEVECAQVSPVVRMLSVDVHWDSQGKVTLKTLIH 133 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10134.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10134.1.1 ID=prot_P-wetherbeei_contig10134.1.1|Name=mRNA_P-wetherbeei_contig10134.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=136bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|