mRNA_P-wetherbeei_contig10134.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10134.1.1 vs. uniprot
Match: A0A7Z9PVL7_9BACT (Uncharacterized protein n=1 Tax=Phycisphaerales bacterium TaxID=2052180 RepID=A0A7Z9PVL7_9BACT) HSP 1 Score: 66.2 bits (160), Expect = 3.230e-11 Identity = 40/134 (29.85%), Postives = 77/134 (57.46%), Query Frame = 1 Query: 16 LNRAGLSLLEVMLAIALMGVVVVGILVVMGGGLRLMNQAGDVTRARELATQEMENIRQSAYAYSPDGTNFDARSGTAAVG--GYPPAPYNPAP--GETYKLAVAVQRVNPTLRSIRVDVYWGVNHNIHLETLMN 405 ++ G+ LLE+++A+ ++ V ++G++ GL++MN++ ++ A E+ +E ++ + Y + GT +D G A G G+PPAPY + Y L V +V+P +R + VDV+W + L+TL++ Sbjct: 1 MSTKGVFLLEIIIALGVVVVAILGLMAAFTAGLKMMNESEKISAATEIGRSFVEQVKTTGYDKTTVGT-YDGWIGEPADGTTGFPPAPYPQVKKQDQDYWLEVECAQVSPVVRMLSVDVHWDSQGKVTLKTLIH 133 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10134.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10134.1.1 >prot_P-wetherbeei_contig10134.1.1 ID=prot_P-wetherbeei_contig10134.1.1|Name=mRNA_P-wetherbeei_contig10134.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=136bp MARSLNRAGLSLLEVMLAIALMGVVVVGILVVMGGGLRLMNQAGDVTRARback to top mRNA from alignment at P-wetherbeei_contig10134:805..1215- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10134.1.1 ID=mRNA_P-wetherbeei_contig10134.1.1|Name=mRNA_P-wetherbeei_contig10134.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=411bp|location=Sequence derived from alignment at P-wetherbeei_contig10134:805..1215- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10134:805..1215- >mRNA_P-wetherbeei_contig10134.1.1 ID=mRNA_P-wetherbeei_contig10134.1.1|Name=mRNA_P-wetherbeei_contig10134.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=408bp|location=Sequence derived from alignment at P-wetherbeei_contig10134:805..1215- (Phaeothamnion wetherbeei SAG_119_79)back to top |