prot_P-wetherbeei_contig11518.5.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: E0XW65_9BACT (Uncharacterized protein n=1 Tax=uncultured Acidobacteria bacterium HF4000_26D02 TaxID=710731 RepID=E0XW65_9BACT) HSP 1 Score: 73.6 bits (179), Expect = 3.460e-16 Identity = 39/54 (72.22%), Postives = 41/54 (75.93%), Query Frame = 0 Query: 1 MQEVRGQVSR------TLPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTSI 48 MQ+ RGQ R LPLLVGIRFQVLFHSP RG+FHLSLTVLVHYRS SI Sbjct: 15 MQKARGQAFRRRSASIALPLLVGIRFQVLFHSPRRGSFHLSLTVLVHYRSPGSI 68
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: E0XU42_9DELT (Uncharacterized protein n=1 Tax=uncultured Desulfobacterales bacterium HF0200_07G10 TaxID=710741 RepID=E0XU42_9DELT) HSP 1 Score: 69.3 bits (168), Expect = 2.180e-14 Identity = 34/52 (65.38%), Postives = 39/52 (75.00%), Query Frame = 0 Query: 1 MQEVRGQVSR------TLPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCT 46 MQ+VRG LPL+VG+RF +LFHSP+RGAFHLSLTVLVHYRS T Sbjct: 1 MQKVRGHTCLHRSKDIVLPLIVGLRFHILFHSPYRGAFHLSLTVLVHYRSST 52
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: H6SIC8_PARPM (Uncharacterized protein (Fragment) n=1 Tax=Pararhodospirillum photometricum DSM 122 TaxID=1150469 RepID=H6SIC8_PARPM) HSP 1 Score: 66.6 bits (161), Expect = 6.070e-13 Identity = 32/38 (84.21%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 10 RTLPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTS 47 + L LLVGIRFQ LFHSPHRGAFHLSLTVLVHYRS S Sbjct: 76 KELRLLVGIRFQELFHSPHRGAFHLSLTVLVHYRSSRS 113
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: A0A0S7HGL4_9TELE (PPUP4096 n=1 Tax=Poeciliopsis prolifica TaxID=188132 RepID=A0A0S7HGL4_9TELE) HSP 1 Score: 66.2 bits (160), Expect = 7.260e-13 Identity = 33/39 (84.62%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 1 MQEVRGQVSRTLPLLVGIRFQVLFHSPHRGAFHLSLTVL 39 MQEVR SR L LLV IRFQVLFHSPHRGAFHLSLTVL Sbjct: 1 MQEVRSHSSRKLLLLVSIRFQVLFHSPHRGAFHLSLTVL 39
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: Q1YII1_AURMS (Uncharacterized protein n=1 Tax=Aurantimonas manganoxydans (strain ATCC BAA-1229 / DSM 21871 / SI85-9A1) TaxID=287752 RepID=Q1YII1_AURMS) HSP 1 Score: 65.9 bits (159), Expect = 8.670e-13 Identity = 32/36 (88.89%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 12 LPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTS 47 L L VGIRFQVLFHSP RGAFHLSLTVLV YRSCTS Sbjct: 64 LHLFVGIRFQVLFHSPCRGAFHLSLTVLVRYRSCTS 99
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: A0A158T0E8_HAEIF (Uncharacterized protein n=1 Tax=Haemophilus influenzae TaxID=727 RepID=A0A158T0E8_HAEIF) HSP 1 Score: 62.8 bits (151), Expect = 3.350e-12 Identity = 30/37 (81.08%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 12 LPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTSI 48 LPLLV RFQVLFHSPHRG+F LS TVLVHYRS SI Sbjct: 3 LPLLVRTRFQVLFHSPHRGSFRLSFTVLVHYRSIRSI 39
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: F6IL44_9SPHN (Uncharacterized protein n=1 Tax=Novosphingobium sp. PP1Y TaxID=702113 RepID=F6IL44_9SPHN) HSP 1 Score: 62.4 bits (150), Expect = 2.380e-11 Identity = 31/39 (79.49%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 1 MQEVRGQVSRTLPLLVGIRFQVLFHSPHRGAFHLSLTVL 39 MQEVR + L LLV IRFQVLFHSPHRGAFHLSLTVL Sbjct: 1 MQEVRCHPLKRLQLLVSIRFQVLFHSPHRGAFHLSLTVL 39
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: UPI001ABF5420 (hypothetical protein n=1 Tax=Xenorhabdus kozodoii TaxID=351676 RepID=UPI001ABF5420) HSP 1 Score: 61.2 bits (147), Expect = 2.560e-11 Identity = 30/37 (81.08%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 12 LPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTSI 48 LPLLV RFQVLFHSP RG+F LSLTVLVHYRS SI Sbjct: 31 LPLLVRTRFQVLFHSPRRGSFRLSLTVLVHYRSVRSI 67
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: A0A1B2YTS5_9BACT (Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1B2YTS5_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 1.980e-9 Identity = 29/48 (60.42%), Postives = 33/48 (68.75%), Query Frame = 0 Query: 1 MQEVRGQVSRTLPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTSI 48 MQ+ R Q ++ L VG RFQVLFH +G FHLSLTVLVHYR SI Sbjct: 11 MQKARRQSTKDLRPFVGARFQVLFHPLIQGTFHLSLTVLVHYRFLRSI 58
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Match: A0A1B2YTL5_9BACT (Uncharacterized protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1B2YTL5_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 5.550e-9 Identity = 31/48 (64.58%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 1 MQEVRGQVSRTLPLLVGIRFQVLFHSPHRGAFHLSLTVLVHYRSCTSI 48 MQ+ R Q S L LV + FQVLFHS +G+FHLSLTVLVHYRS SI Sbjct: 11 MQKARRQ-SEDLRPLVSVWFQVLFHSLIQGSFHLSLTVLVHYRSLRSI 57 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11518.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 16
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11518.5.1 ID=prot_P-wetherbeei_contig11518.5.1|Name=mRNA_P-wetherbeei_contig11518.5.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=49bpback to top |